KEGG   Falco cherrug (Saker falcon): 102048671
Entry
102048671         CDS       T02911                                 

Gene name
WASL
Definition
(RefSeq) neural Wiskott-Aldrich syndrome protein isoform X1
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04144  Endocytosis
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102048671 (WASL)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102048671 (WASL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102048671 (WASL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102048671 (WASL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102048671 (WASL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102048671 (WASL)
Membrane trafficking [BR:fch04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    102048671 (WASL)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     102048671 (WASL)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 102048671
NCBI-ProteinID: XP_005441839
LinkDB
Position
Unknown
AA seq 465 aa
MSSAVVQIYAADRNAMWSKKCCGVACLVKDNPQRSYFIRIFDIKDGKLLWEQELYNNFVY
NSPRGYFHTFAGDTCQVGLNFANEEEAKLFRKTVTDLLGRRQRKSEKRRDPPNGPNLPMA
TVDIKNPEITTNRFYTPQVNNISYTKEKKKGKTKKRRLTKADIGTPSNFQHIGHVGWDPN
TGFDVNNLDPELKNLFDMCGISEAQLKDKETSKVIYDFIEKTGGVEAVKNELRRQAPPPP
PPCRGGPPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGASVPPPPP
NRMYPPPPPVHSSSAPSGPPPPPPPPASGSSVPPPPPPPPPPPGPPPPPGLPSEVDHQLP
VPVGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESAPPT
PAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWDD
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgtcttcagcagttgttcagatatatgcagcagatcgcaatgccatgtggtcaaagaaa
tgctgtggtgtagcttgccttgtaaaggacaatccacagaggtcgtattttatcagaata
tttgacattaaggatggaaaattattgtgggagcaggagctgtacaataactttgtatat
aatagtcctagaggatattttcatacctttgctggagatacatgtcaagttggtcttaat
tttgctaatgaagaagaagctaaactattccgcaaaacagtaacagatttacttggacga
cggcagagaaaatctgaaaaaagacgagacccgccaaatggcccaaatctaccaatggca
actgttgatatcaaaaacccagaaattacaactaacaggttttatactccacaagttaac
aatatttcatataccaaagaaaagaagaaaggaaaaactaaaaagagaagattgacaaag
gcagatattggaacaccatctaatttccaacacattggacatgttggttgggatccaaac
acaggtttcgatgtgaacaacttagacccagaactgaaaaacctgtttgatatgtgtgga
atttcagaggctcaactaaaagacaaagaaacttcaaaggtcatatatgatttcattgaa
aaaacaggaggtgtggaagctgttaaaaatgaactgcgcagacaagctccaccgccacca
ccaccgtgcagaggaggaccccctccacctccaccaccccctccccatagctcaggccct
cctcctccccctgctaggggccgaggggcaccacctccacctccttctagagctcccaca
gcagcacctccacccccacccccatctagacctggtgcatcagtgcccccacctcctcca
aacaggatgtatcctcctccaccaccagtgcattcatcatctgcaccttccggccctcct
cctccgccaccaccaccggcaagtgggtcgtctgttcctccaccccctcctcctcctcca
ccccctcctggtcctcctccaccaccaggccttccttcagaggttgatcaccagcttcca
gttcctgtaggaaacaaagcagcactcttggatcaaatcagagaaggagctcagttaaag
aaggtcgaacagaacagtcgaccggtatcctgctcaggaagagatgcactgttagaccag
atacgacagggtatacagctgaaatccgtatctgatggtcaagagagtgcaccacctaca
cctgcgcccacctcaggaattgtgggtgcattaatggaagttatgcagaaaaggagcaaa
gccattcattcttcagatgaagatgaggatgaagatgatgaagaagactttgaggatgat
gacgaatgggatgattga

DBGET integrated database retrieval system