KEGG   Falco cherrug (Saker falcon): 102049194Help
Entry
102049194         CDS       T02911                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00250  Alanine, aspartate and glutamate metabolism
fch00280  Valine, leucine and isoleucine degradation
fch00410  beta-Alanine metabolism
fch00640  Propanoate metabolism
fch00650  Butanoate metabolism
fch01100  Metabolic pathways
Module
fch_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102049194 (ABAT)
   00650 Butanoate metabolism
    102049194 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102049194 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    102049194 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102049194 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fch01007]
    102049194 (ABAT)
Enzymes [BR:fch01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102049194 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102049194 (ABAT)
Amino acid related enzymes [BR:fch01007]
 Aminotransferase (transaminase)
  Class III
   102049194 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102049194
NCBI-ProteinID: XP_005441582
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MASMLLSRQLTCCLQQNSRLLVFGHRYISQAAAKIDVDFDYDGPLMKTEVPGPRSRELMK
QLNGIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPSLIKLLQQPQ
NLSTFINRPALGILPPENFAERLKESLLSVAPKGLPQVITMSCGSCSNENAFKAIFMWYR
NKERGHTNVTKEELESCMINQPPGCPDYAMLSFMGGFHGRTLGCLATTHSKAIHKLDIPS
LDWPIAPFPRLKYPLEDFVKENQQEEARCLEEVEDLIVKYRKKKKIVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVVTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLMLAEVIKVIKREDLLNNATHAGKALLTGLL
DLQARYPHLISRVRGRGTFCSFDTPNDATRNKLITIARNKGVVLGGCGDRSIRFRPTLIF
KDHHAHLFLNIFSDILANFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatgttgcttagtcgacagctgacctgttgcctgcagcaaaactccaggctg
cttgtatttggacacagatatatcagtcaagctgctgctaaaattgatgttgattttgat
tatgacggacctctaatgaagacagaagttcctggaccacgatctagagaattaatgaag
cagctgaatggcattcagaatgcagaagctgtacactttttttgcaattatgaagagagc
agagggaactacctagtagatgtagatggcaatcgcatgctggatctctactctcagatt
tcatccattccaataggttacagccatccctctctgataaagcttctacagcagccacag
aacttgagcacttttatcaacagacctgctctagggattttacctccagagaactttgca
gaaagactgaaggaatctttgctatcagtggctcctaagggcctgccacaggtgatcacc
atgtcttgcggatcctgctccaatgaaaatgcctttaaagcaatatttatgtggtacaga
aacaaggagaggggccatactaatgtcacaaaagaggaactggaatcttgcatgattaac
cagccccccggctgccccgactacgccatgctctccttcatgggcggcttccacggaagg
accctgggttgcttagctacaactcactctaaagccattcataagttggacattccatcg
ctggactggcctattgctccatttccaaggctgaagtatcctctggaagactttgtgaaa
gagaatcaacaggaagaagcccgttgtttagaggaggtggaagacctgattgtaaagtac
aggaaaaagaagaagattgtggctggaatcattgtagaacccatccagtcagagggaggg
gacaaccacgcttcagatgacttcttcagaaagctacgagatattgccagaaagcatggc
tgtgcgttcttggtggatgaggtgcagacgggaggcggctgcacaggaaaattctgggca
catgaacactggggcctggatgacccagctgatgtggtaacgttcagtaagaagatgatg
acaggaggatttttccacaaagaggagttcaggccaaacgctccctatcgaatttttaac
acctggcttggagatccatccaagaacctcatgcttgctgaagtcattaaggttataaag
agagaagaccttctaaacaatgcaacccacgccgggaaagctctgctgactgggctgctg
gatttacaggctcgttatccccatctcatcagcagagtgagaggaagaggaacattctgt
tcgtttgacactccaaatgatgcaactagaaacaagttgattacaatagccagaaacaaa
ggtgtggtgctgggaggctgtggcgacagatcgattcgtttccgtccaacgctgatcttc
aaagatcaccatgcgcacctcttcctgaacattttcagtgatatcttagcaaacttcaag
taa

DBGET integrated database retrieval system