KEGG   Falco cherrug (Saker falcon): 102049222
Entry
102049222         CDS       T02911                                 

Gene name
PTPN6
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 6 isoform X2
  KO
K05697  tyrosine-protein phosphatase non-receptor type 6 [EC:3.1.3.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102049222 (PTPN6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102049222 (PTPN6)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102049222 (PTPN6)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    102049222 (PTPN6)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 DUF4941 PTPlike_phytase MRNIP
Other DBs
NCBI-GeneID: 102049222
NCBI-ProteinID: XP_005434374
LinkDB
Position
Unknown
AA seq 606 aa
MVRWFHRDLSGLEAEALLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNTGDF
YDLYGGEKFATLSELVEYYTQQQGSLQDKDGTIIDLRYPLNCSDPTTERWYHGHLSGPAA
ESLLQAKATPWTFLVRESLSKPGDFVLSVLTDQLKPGSDAAPAGASSASGARLKVTHIKI
MCENGRYTVGGAETFDSLADLVEHFKKTGIEEVSGSFVYLKQPYYATRVNAADIENRVQE
LNKKSVSEETSKAGFWEEFDSLQKQEAKHLFDRHEGQRPENKSKNRYKNILPFDHSRVIL
QGRDPNIPGSDYINANYVKNNLISPDECTKTYIASQGCLDATVNDFWQMVWQENTRIIVM
TTREVEKGRNKCVPYWPEVGSTKEYGPYLVETTGEHDALEYKLRHLCVCPMDNGKAAREI
WHYQYLSWPDHGVPSEPGGVLSFLDQINQKQESIPDAGPILVHCSAGIGRTGTIIVIDMI
VDTISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYMAICQFIETTKKKLEVIQSQ
KGKPNESEYGNIAYPPAVRNVHAKASRKSSKQKEESTVYENLGKKEEKVRKQRSSEKKLK
GSLKKK
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggtgaggtggtttcaccgtgacctgagtgggctggaagctgaagccttactgaaggga
cgaggtgtccatgggagctttctggccagacccagtcggaagaatcaaggggatttttct
ctttcagtccgggttggcgatcaggtaacccacatccgcatccagaatactggggatttc
tatgacctgtatggaggggagaagtttgccaccttgtcagaactggtggagtactacacg
cagcaacagggctcgctgcaggacaaagatggaaccatcatcgacttgcgatacccgctc
aactgttctgaccccactacagagaggtggtaccatgggcatctgtcaggccctgcagct
gagtcacttctccaggccaaagccaccccttggaccttcttggtgcgggagagcctcagc
aaacccggggattttgtcttgtctgtcctcactgaccagcttaaacctgggtctgatgct
gcaccagctggggcaagcagtgcctctggggcccggctcaaagtcacgcacatcaagatc
atgtgtgagaatggacgctacacagttggaggtgctgagacgtttgacagcttggcagat
ctggtggagcacttcaagaagactggaattgaggaggtgtctggctcctttgtgtatctg
aagcagccctactacgctacgagggtgaatgctgccgacattgagaatagggtgcaggaa
ctgaacaagaagagtgtctctgaggagacgtccaaggctggattctgggaggaatttgat
agcctgcaaaaacaggaagccaagcacctgtttgaccgtcacgagggtcagagacctgaa
aacaagagcaagaatcgatacaagaacatcttgccctttgatcactccagagtcatcctc
caaggaagggacccaaatatacctggatctgactatatcaatgccaactatgtcaagaac
aacctcatcagcccggatgagtgcaccaagacctacatcgctagccagggttgcctagat
gccacagtcaatgacttctggcaaatggtgtggcaggagaacacgcgcattattgtgatg
actacacgggaagtagaaaaagggcggaacaaatgtgttccttactggccagaggtgggc
agcacgaaggaatatggtccctaccttgtggagaccacaggagagcacgacgcattggag
tacaaactccggcacctctgtgtgtgtccgatggataatggtaaggctgcacgcgagatc
tggcactaccagtacctgagctggcctgaccacggggtacccagtgagcccggaggagtg
ctcagcttccttgaccaaataaaccagaagcaagagagcatccccgatgcagggcctatt
ctggtccattgcagtgccgggatcggccgcactgggactatcatcgtcatcgatatgata
gtggatacaatctccaccaaggggctggactgtgacattgacatccagaagaccatccag
atggtgagggcccagcgctcagggatggtgcagacggaggctcagtacaagttcatctac
atggccatctgccagttcatagagacaaccaagaaaaagctggaagttatccagtctcag
aaaggcaagccaaacgagtctgagtacgggaacattgcctacccccccgcagtgaggaat
gtgcatgccaaggcttcgcgaaaatcctccaagcagaaagaggagtccacagtttatgag
aacttggggaaaaaggaggagaaggtgcggaaacagcgttcctcagagaagaaactgaaa
ggctcactgaagaaaaaataa

DBGET integrated database retrieval system