KEGG   Falco cherrug (Saker falcon): 102049227
Entry
102049227         CDS       T02911                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
fch  Falco cherrug (Saker falcon)
SSDB
Motif
Pfam: TUSC2 RA C1_1 PHD
Other DBs
NCBI-GeneID: 102049227
NCBI-ProteinID: XP_005435614
LinkDB
Position
Unknown
AA seq 275 aa
RRGLHTWCDLCGDFVWGGGRKSLQCRHCSFICHYRCRALVRLDCSGPPSTSDEDDGNEQA
LEKDTNVDEPSEWEKAELDQAQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVR
PVSVPATKRVPSLQAGRMGPHTQGVKRRTSFYLPKGTVKHLHILSHTRASEVIDALLRKF
TVVDNPHKFALFERSEKDEQVYLRKLADEGQTLPSMYYDEDGDLAHEFYEETIVTKNGRK
RAKLKRIHKNLIPQGIVKLEHPRIHVDFPVIICEV
NT seq 828 nt   +upstreamnt  +downstreamnt
cgccgcgggctccacacctggtgcgacctctgcggggacttcgtctggggcggcggcagg
aagagcctccagtgccgccactgcagcttcatctgccactaccggtgccgggccttggtg
cggctggactgcagcggccccccgagcaccagcgatgaggacgatggcaacgagcaggca
ctggagaaggacaccaacgtggatgagcctagtgagtgggagaaggcagagctggaccag
gcacaggtggagcagcggatcaaggagtacaacagccaaatcaacagcaacctcttcatg
agcctgaacaaggatggctcctacactggctttatcaaggtgcagctgaagctggtgcgc
cctgtctcggtgccggccaccaagcgggtcccctccctgcaggcggggcggatggggccg
cacacccagggggtgaagcgccgcacatccttctacctgcccaaggggactgtcaagcac
ctgcacatcctctcgcacacccgtgccagcgaggtcatcgatgccctcctccgcaagttc
accgttgtggataacccccacaagttcgccctcttcgagaggtctgagaaggatgagcaa
gtgtacctgcggaagctggctgacgaggggcagacgctgccctccatgtactacgatgag
gacggggatctcgctcacgagttctacgaggagacaatcgttaccaagaacgggaggaag
cgcgccaagctgaagaggatccacaagaacctgatacctcagggcatagtgaaactggag
caccctcgcattcacgtggatttccctgtgatcatctgcgaggtgtga

DBGET integrated database retrieval system