KEGG   Falco cherrug (Saker falcon): 102049811
Entry
102049811         CDS       T02911                                 

Gene name
FARP2
Definition
(RefSeq) FERM, ARHGEF and pleckstrin domain-containing protein 2 isoform X3
  KO
K06082  FERM, RhoGEF and pleckstrin domain protein 2
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102049811 (FARP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:fch04990]
    102049811 (FARP2)
Domain-containing proteins not elsewhere classified [BR:fch04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102049811 (FARP2)
SSDB
Motif
Pfam: RhoGEF PH FERM_C FERM_N FA FERM_M IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 102049811
NCBI-ProteinID: XP_014133019
LinkDB
Position
Unknown
AA seq 1048 aa
MGEIEGTYRVLQTPGSRLGVQKNAGVSTLEPGQNLSTAVASSPAKMHERDLPIKIKMLDN
TVEVLDIESKYYGQTLLTEVYKHLNLIESDYFGIEFQNIQSYWIWLEPMKPVIKQVRRPK
TTMLRLAVKFFPPDPGQLQEEYTRYLFALQIKRDLAEERLTCSDNTAALLVSHLLQSEIG
DFDESEDREHLKTNQYLPNQERIEGKILEFHRKHVGQTPAESDFQVLEIARKLEMYGIRF
HLASDREGTKINLAVSHMGVLVFQGNTKINTFNWSKVRKLSFKRKRFLIKLHPEVCGPYQ
DTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVFFTRGSSFRYSGRTQKQLVD
YIKDSGMKKTPYERRHSKVRASTRASNTDMPKQSVPFTEGLRTPGSPASAAAPFHSVHAS
AIPTPILPIFAETSPSSVDPRAPYTRNPEKNTAVPAEEAGRKLMQQPGSPMLQGLRVDHP
QLSSIMLKCPLGLNPAFQVNLNAASHGPSLLSPVLSDAGGARIEEDDEMKRKRYPTDKAY
FIAKEILATERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYEFHRGFLKEI
EQRLSLWEGKTNAHVKGDYQRIGDVMLRNMRTLKEFTSYLQKHDEVLTELEKATKRLKKL
ETVYKDFELQKVCYLPLNTFLLKPIQRLMHYKLILARLCKHYTAEHRDFADCRNALKEVT
EMTSQLQQSLIRLENFQKLTELQHDLIGIDNLTAPDREFIREGCLYKLTKKGLQQRMFFL
FSDMLLYTSKGVTGTNQFKIHGHLPLHGMLVEESENEWAVPHCFTIYSAQKTIVVAASTR
LEMGKWMEDLNMAIEMAKKSTEKSDMLLENSVCNRSNRSSDEVSLEQESEDDIHSSRSSL
DRQSHHRANTTMHVCWYRNTSVSMTDHSVAVENQLSGYLLRKFKNSNGWQKLWVVFTNFC
LFFYKTHQDDYPLASLPLLGYAVSSPVEADGIQKDYVFKLQFKSHVYFFRAESKYTFERW
MEVIKRATSSPARSSLLMPKDEKDSHTD
NT seq 3147 nt   +upstreamnt  +downstreamnt
atgggagagatagaaggaacgtacagagtcttgcagactcctggctctcgtttgggtgtc
cagaaaaatgcgggagtgagtaccttggagccgggacagaacctctctactgcagtggca
tcatctcctgccaaaatgcacgagcgggacctaccgatcaaaataaagatgttggacaac
acggtggaagtacttgacattgagtcaaaatattatggccaaacattattgacagaagtt
tacaagcatctgaatttgattgaatcggactactttgggatcgagttccagaacatccaa
tcatattggatttggctggaacctatgaaacctgttattaaacaagtacggagaccaaag
actacaatgcttcgtctagctgtgaagtttttccctccagacccgggtcagctgcaggag
gaatatactaggtacctgtttgcgttgcaaatcaagagagatttggcagaggagcgactg
acctgcagcgacaatacggccgctcttctggtctcacaccttctgcaatctgaaataggg
gatttcgatgaatcagaggatcgagaacaccttaaaacaaaccagtatttgccaaaccag
gaaagaattgaagggaagattctggagttccacaggaagcatgtgggtcaaactcctgct
gaatcagactttcaagtgcttgaaattgctcggaaactggagatgtatggcatcagattt
caccttgcatctgaccgtgagggcaccaaaattaatctagctgtttcacacatgggtgtg
ctggtattccagggtaatacgaaaatcaataccttcaactggtcaaaggtccgtaagcta
agcttcaagaggaaaagattccttattaaactccacccagaggtctgtggtccgtatcaa
gatacgttggagtttcttttgggaagtagggatgagtgtaaaaacttctggaaaatctgt
gttgaatatcacacgttctttaggctctttgatcagccaaagccgaaggctaaagcagtg
ttcttcaccagagggtcatcattcagatacagtggacgaacacagaagcaactagtggat
tatattaaggacagtgggatgaagaaaacaccatatgaaaggaggcacagcaaggtcaga
gcgtccactcgtgcttcgaacacagacatgccaaagcagagtgtcccattcactgagggc
ttgagaaccccagggtctcctgcctcagcagctgcccccttccactcagttcacgcatcg
gccattcctactcccatcctgcccatctttgcagaaaccagcccttcctctgtggacccc
cgagcgccatacacaaggaatccagaaaaaaacactgcagtgccagcagaagaagcaggg
aggaaactgatgcagcagcctggatctcccatgctccaaggcctccgagtggaccatcct
cagctctcttccatcatgctgaagtgtcccctgggcttgaacccagcatttcaggtgaac
ttgaacgcagccagccacggtccgtctcttctgagtcctgtccttagtgatgctggtggt
gctaggatagaagaggatgatgaaatgaaacgtaagcgctatccaactgacaaggcatac
ttcatagcaaaggagattcttgctacagaacggacgtatttaaaggacctggaagtgatt
acagtgtggtttcgcagcgcagtcatcaaggagaacgctatgccagagggcctgatgaca
ttacttttctctaacatagacccaatttatgagtttcatcgaggctttctgaaagagatt
gagcaaaggctgtcgctctgggaaggaaaaaccaatgctcatgtgaaaggagattatcag
cgcattggagatgtcatgctcaggaatatgcgtactctaaaggagtttaccagttatctg
cagaagcatgatgaggtcttgactgaactggagaaagcaactaagcgcctaaagaagcta
gaaacggtatataaggattttgagctgcagaaggtttgctacctgcccctcaacacgttc
ctgctcaaaccaatccagagactgatgcactacaagttgatcctggcgagactttgcaag
cactacacagcagagcaccgggactttgcagattgccggaatgcgctgaaggaagtcaca
gaaatgacatctcagctgcagcagagtctcatccgcctggagaatttccagaagctgaca
gagctgcagcatgacttgattggtatagacaatcttacagcgcctgatagggagtttatc
cgggaaggctgcttgtacaagctcactaagaagggtttacagcagcggatgttctttctg
ttctcggatatgttactctacacaagcaaaggggttacagggacaaatcagttcaaaatt
catggacatcttccactgcatggcatgttggtggaggagagtgagaatgaatgggctgtc
ccacactgcttcaccatctattcagcacaaaaaaccatagtggtggcagcaagtacccgc
ctggagatggggaagtggatggaagacctaaacatggcaattgaaatggccaagaaatct
actgagaaatctgacatgcttctggagaactcagtatgcaatcgctccaacagatcctct
gatgaggtctctctagaacaggagtccgaagatgacatacactcttctcgtagctccttg
gacaggcagagccaccaccgtgccaacacaaccatgcacgtgtgctggtaccgcaacaca
agcgtctccatgactgaccacagtgtggctgttgagaaccagctctctggatacttgctg
aggaagttcaagaacagcaatggctggcagaaactgtgggttgtcttcaccaacttctgc
ttgttcttctacaaaacgcaccaggatgattatcccttggccagtctcccgctgcttggc
tacgcagtcagctcccctgtggaggcagacggtattcagaaggattatgtcttcaagctg
cagttcaagtcccatgtgtatttcttcagggctgagagcaaatacacctttgagaggtgg
atggaggtgatcaagagagccaccagctctccagccaggtcgagcctgctgatgccaaag
gatgagaaggacagtcacacagactga

DBGET integrated database retrieval system