KEGG   Falco cherrug (Saker falcon): 102049998
Entry
102049998         CDS       T02911                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X2
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04145  Phagosome
fch04310  Wnt signaling pathway
fch04370  VEGF signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04530  Tight junction
fch04620  Toll-like receptor signaling pathway
fch04810  Regulation of actin cytoskeleton
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102049998 (RAC1)
   04310 Wnt signaling pathway
    102049998 (RAC1)
   04370 VEGF signaling pathway
    102049998 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102049998 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102049998 (RAC1)
   04520 Adherens junction
    102049998 (RAC1)
   04530 Tight junction
    102049998 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102049998 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102049998 (RAC1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102049998 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102049998 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102049998 (RAC1)
   04031 GTP-binding proteins [BR:fch04031]
    102049998 (RAC1)
Membrane trafficking [BR:fch04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102049998 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102049998 (RAC1)
  Macropinocytosis
   Ras GTPases
    102049998 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102049998 (RAC1)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102049998 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   102049998 (RAC1)
  Exosomal proteins of colorectal cancer cells
   102049998 (RAC1)
  Exosomal proteins of bladder cancer cells
   102049998 (RAC1)
GTP-binding proteins [BR:fch04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102049998 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 102049998
NCBI-ProteinID: XP_014138103
LinkDB
Position
Unknown
AA seq 192 aa
MCFTCKLSLFYSAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtgttttacatgtaaactttctcttttttacagtgctgtaggtaaaacatgcctactc
atcagttacacaaccaatgcgtttcctggagaatatatacccactgtctttgacaactac
tctgctaatgtaatggttgatggaaaaccggtcaacctgggtttgtgggatacagctggt
caagaggactatgacagactacgtccgctctcctatccgcaaacagatgtcttcttaatc
tgcttttcccttgtgagtcccgcttcctttgaaaatgtccgtgctaagtggtatcctgag
gtgcggcaccattgtcccaacacccccatcatcttagtgggtaccaaactcgatctccgg
gatgataaggacactattgaaaaactgaaggagaagaagctgactcctatcacctaccca
cagggccttgccatggcaaaagagatcggtgcagtgaaatacctggaatgctcagcactt
acgcagcgaggcctcaagacagtgtttgatgaagctatccgagcagttctgtgcccccct
cctgtaaagaagaggaagagaaaatgtctgctgctgtaa

KEGG   Falco cherrug (Saker falcon): 102054322
Entry
102054322         CDS       T02911                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04310  Wnt signaling pathway
fch04370  VEGF signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102054322 (RAC3)
   04310 Wnt signaling pathway
    102054322 (RAC3)
   04370 VEGF signaling pathway
    102054322 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102054322 (RAC3)
   04520 Adherens junction
    102054322 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102054322 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:fch04031]
    102054322 (RAC3)
GTP-binding proteins [BR:fch04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102054322 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 102054322
NCBI-ProteinID: XP_014133153
LinkDB
Position
Unknown
AA seq 148 aa
MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHH
CPNTPIILVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRG
LKTVFDEAIRAVLCPPPVKKPGKKCTVF
NT seq 447 nt   +upstreamnt  +downstreamnt
atggtagatggaaagccagtgaacctaggcctctgggatacagcagggcaagaggattat
gaccgactgcggcctctttcctatccacagacggatgttttcttgatctgcttctccctt
gtgagtccagcctcctttgagaatgtcagagccaagtggtaccctgaggtccgacaccat
tgcccaaatacacctatcatcctggttggcaccaagctggacttaagggatgataaggac
accattgaaaggttacgtgataagaaactggcccccatcacctaccctcaaggtttagcc
atggctcgggagattgggtcggtaaagtacctcgagtgctctgccctgacacagcggggc
ttgaagacggtgtttgatgaagccatccgggctgtgctctgcccaccgcctgtgaagaag
cctggcaaaaagtgtaccgtgttttga

KEGG   Falco cherrug (Saker falcon): 102059263
Entry
102059263         CDS       T02911                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 isoform X1
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04310  Wnt signaling pathway
fch04370  VEGF signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102059263 (RAC2)
   04310 Wnt signaling pathway
    102059263 (RAC2)
   04370 VEGF signaling pathway
    102059263 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102059263 (RAC2)
   04520 Adherens junction
    102059263 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102059263 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:fch04031]
    102059263 (RAC2)
GTP-binding proteins [BR:fch04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102059263 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 102059263
NCBI-ProteinID: XP_005446781
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLSPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRTKKRACSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagccatcaagtgtgtcgtggtgggagacggagctgtggggaaaacctgtctcctt
atcagctacactactaatgctttcccaggagaatacatccccactgtgtttgataactat
tccgccaacgtgatggttgacagcaagcctgtaaatctggggctatgggatactgctgga
caagaggattatgacaggctgaggccactctcttacccgcagacggatgtcttcctgatc
tgcttctcccttgtcagcccagcatcttatgaaaatgtccgtgctaagtggttccctgaa
gtgcggcaccactgccctagcactcccatcatccttgtgggcacaaagctggaccttcgt
gatgacaaagacaccatcgagaagctgaaggagaagaagctatccccaattacatatcct
cagggccttgctctagccaaggaaatcgactctgtgaaatacctcgaatgctcagctttg
acgcagcgtggcctcaagacagtgtttgacgaggccatccgagcagtcctctgcccacag
cccacacggacgaagaaacgtgcatgcagcctcctctaa

DBGET integrated database retrieval system