KEGG   Falco cherrug (Saker falcon): 102050307
Entry
102050307         CDS       T02911                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04310  Wnt signaling pathway
fch04520  Adherens junction
fch04916  Melanogenesis
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102050307 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102050307 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102050307 (LEF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102050307 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102050307 (LEF1)
Transcription factors [BR:fch03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102050307 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102050307
NCBI-ProteinID: XP_027670771
LinkDB
Position
Unknown
AA seq 379 aa
MSRFQRGDGQSRASSAPLRARGWSGKGGRGGRPPLRFGPGRESSRESPDGAVVSRQTQAQ
DSYHDKGREHSEEGKHPDSGLYSKGPSYSGYSGYIMMPNMNNDPYMPNGSLSPPIPRTSN
KVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDLPTFYPLS
PGGVGQITPPLGWQGQPVYPISSGFRQPYPSSLSVDPSMSRFSHHMIPGPPGPHTTGIPH
PAIVTPQVKQEHPHNDSELMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAE
CTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKR
EKLQESASGTGPRMTAAYI
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtcccgtttccagaggggcgacgggcagagccgcgcgagctccgcgcccctccgcgcc
cggggatggtccgggaagggggggcggggggggcggccccctctgcgcttcggcccggga
cgagaaagttcccgcgagtcccccgacggtgcggtggtttcgaggcagacccaagcgcag
gattcctaccatgataaaggcagagagcactccgaggaaggaaagcatccagacagtggc
ttatacagcaagggaccatcatactctggttattctgggtatatcatgatgccaaatatg
aataacgacccgtacatgcctaatggatctctgtcgccacccatccccagaacatcaaac
aaggtgccagtggtacagccttctcatgcggttcaccccctcaccccccttatcacttac
agcgatgagcacttttccccagggtcgcacccatctcacatcccctcagacgtcaactcc
aagcaaggcatgtccaggcatcctccagctcctgatctccctaccttctatcccttgtct
ccagggggggttggacagataacaccacctcttggctggcaaggtcagcctgtatatccc
atctcgagtggattcaggcagccctatccatcctcactctcagtcgacccttccatgtcc
aggttttcacatcacatgattcctggtcctccaggccctcacacaactggaatccctcac
ccagctattgtaacacctcaagtaaaacaagaacatccgcacaacgacagtgagctaatg
catgtgaagcctcagcacgaacagagaaaagaacaagagccaaaaagacctcatattaag
aaacctctgaatgctttcatgttgtacatgaaagaaatgagagcgaacgttgtagcagag
tgtactctgaaagaaagcgcagctatcaaccagattcttggcagaaggtggcatgctctc
tcccgtgaagaacaagcaaaatattatgaactagctcgtaaagaaaggcagctacacatg
cagctttatccaggctggtctgcaagagacaactatgggaagaaaaagaagaggaagaga
gaaaagttgcaggaatcagcatcaggtacaggccccagaatgacagctgcctacatctga

KEGG   Falco cherrug (Saker falcon): 102051021
Entry
102051021         CDS       T02911                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04310  Wnt signaling pathway
fch04520  Adherens junction
fch04916  Melanogenesis
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102051021 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102051021 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102051021 (TCF7L1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102051021 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102051021 (TCF7L1)
Transcription factors [BR:fch03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102051021 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102051021
NCBI-ProteinID: XP_027659686
LinkDB
Position
Unknown
AA seq 406 aa
MHPLTPLITYSNDHFSPGSPPGHLSPEIDPKTGIPRPPHPSELPPYYPLSPGAVGQIPHP
LGWLVPQQGQPVYSIPPGGFRHPYPALAMNASMSSLMSSRFSPHMVPPPTHGLHPSGIPH
PTIVSPIVKQEPTQPNISPGGNSKSPVTVKKEEEKKPHIKKPLNAFMLYMKEMRAKVVAE
CTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKR
EKLAQQQSHDTESSLASKSKKPCVQYLPAEKPCDSPASSHGSMLDSPATPSAALASPAAP
AATHSEQAQPLSLTTKPEARAQLTVHSATFLSGKATSSSSSSSSSSSSSSLSSPPSLLSR
PIPFTSVPSTALLSSPPSFAAAIPSPQAALAVLQTQPLSLVTKPAD
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgcacccgctgacaccgctcatcacctacagcaacgaccacttctcgccaggctcaccg
cccggccacctctcaccggagatcgacccaaagacgggaatccctcggccgccgcaccca
tccgagctgcccccttattacccgctgtcacccggagccgtgggccagatcccgcacccg
ctgggctggctcgtgccgcagcaaggacagcccgtgtactcaatccctcccggcggcttt
cggcacccctaccctgccctcgccatgaacgcctccatgtccagtttgatgtccagccgt
ttctccccgcacatggtcccaccacccacccatgggctgcacccctcaggcatcccgcac
ccgaccatcgtctcgcccatcgtgaagcaggaacccacccagcccaacatcagccccgga
ggcaactcgaaatcccccgtcactgtgaagaaggaggaggagaagaaaccccacatcaag
aagccgctcaatgccttcatgttgtacatgaaggagatgagggccaaggtggtggccgag
tgcacgctgaaggagagcgccgccatcaaccagatcctgggcagacgatggcactcgctg
tcgcgggaggagcaggcaaagtactatgagctggcacggaaagagcggcagctgcactcc
cagctctacccgacgtggtcggcacgggacaactatggcaagaaaaagaagagaaagcga
gagaagctggcccagcagcaaagccacgacacggagagctcgctggcatccaagagcaag
aagccgtgcgtgcagtacctgccagccgagaagccgtgtgacagccctgcgtcctcccac
ggcagcatgttggattcgcccgccacgccgtcggccgccctggcatccccggccgcgccg
gctgccacccactcggaacaggctcagcccctctcgctcaccaccaagccagaggccagg
gcgcagctcaccgtgcattcagccaccttcctctcgggcaaagccacctcttcttcctcc
tcctcttcctcctcttcctcctcctcaagcctcagcagcccgccctcgctcctctccaga
cccatccccttcacctcggtgccctccacggctctcctgtcctcgcctccgtccttcgca
gctgccatcccatccccgcaggctgctttggccgtgctgcaaacgcagcccctttccctg
gtcaccaaacctgctgactaa

KEGG   Falco cherrug (Saker falcon): 102053252
Entry
102053252         CDS       T02911                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X5
  KO
K04491  transcription factor 7-like 2
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04310  Wnt signaling pathway
fch04520  Adherens junction
fch04916  Melanogenesis
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102053252 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102053252 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102053252 (TCF7L2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102053252 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102053252 (TCF7L2)
Transcription factors [BR:fch03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102053252 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102053252
NCBI-ProteinID: XP_014139294
LinkDB
Position
Unknown
AA seq 394 aa
MKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTP
GNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITT
GGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHSLHTTGIPHPAIVTPTVKQESSQSDV
GSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRW
HALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNDLSAPKKCR
ARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCVSPPSSDGSLLDSPPSSPAMLASPSRDSK
PQTEQTQPLSLSLKPDPLAHLVRPPSRRPLPPHP
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaaatggccactgcttgatgttcaggcagggagccttcagagtagacaagccctcaag
gatgctaggtctccatctccagcacacattgtttctaacaaagtgccagttgtgcagcac
ccacaccatgtacaccctcttacgccgcttatcacgtacagcaatgagcacttcacaccg
ggaaaccctcctccacacttaccagccgacgtagatcccaaaacaggaattccaaggcct
ccacatcctccagatatatctccttattatccgttatcaccaggcactgtaggacaaatc
ccccatccgctaggatggttagtaccacagcaaggtcagccagtgtacccaatcacgacg
gggggtttccgccacccttacccaacagctctgactgtcaatgcttccatgtcaagcttt
ctctcctctaggtttcctccacacatggtcccgccacaccatagtttacatacaactgga
atccctcatccggccatagtcacaccaacagtcaaacaggaatcttcccagagcgatgtc
ggctcactccacagctcaaaacatcaggactccaaaaaagaagaagagaaaaagaagcca
cacataaagaaacctcttaatgcatttatgttgtatatgaaggaaatgagagcaaaagtt
gtagcagaatgcacattgaaagagagtgcagccatcaaccaaatcctcggtcgaaggtgg
cacgcgttatccagagaagaacaagcgaaatactatgaactagcaagaaaggagcgacag
cttcatatgcagctgtacccgggctggtccgcacgggataactatggaaagaagaagaag
aggaaaagggataagcagccaggagagaccaatgacctgagcgctcctaagaaatgccga
gcgcgctttggccttgatcaacagaataactggtgcggcccctgcaggagaaaaaaaaag
tgcgttcgctacatacaaggtgaaggcagctgcgtcagcccaccctcttcagatggaagc
ttactagactctcctccgtcctcccccgccatgctcgcctccccctccagagactcgaaa
ccacagactgaacaaacgcaacccctctcgctctcattgaagcccgacccgctggcgcac
ctggtccggccgccctcccgccggccgctgccgccgcatccctag

KEGG   Falco cherrug (Saker falcon): 102058554
Entry
102058554         CDS       T02911                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7
  KO
K02620  transcription factor 7
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04310  Wnt signaling pathway
fch04520  Adherens junction
fch04916  Melanogenesis
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102058554 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102058554 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102058554 (TCF7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102058554 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102058554 (TCF7)
Transcription factors [BR:fch03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102058554 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 102058554
NCBI-ProteinID: XP_027663240
LinkDB
Position
Unknown
AA seq 492 aa
MPQLGSGGGDDLGATDEMLAFKDEGEQEEKIPENAFTERDLADLKSSLVNESEGTKHPAA
SSGPPTGRGITCRRATLDGELLILAGMKHQDPGMYKGSAYSGYPFLMLSDPYLPNGSMSP
LSNKVPVVQPSHGVHPLTPLIPYSNDHFSHGSHSPHLPADINQKQGVHRPSQTSDIPGFY
PLPPGGVGQITPSMGWQSQSVYPLPSCGFRQPYSSALSAGASFSRFTHPLMLGSGMHTTG
IPHPAIVPHSGKQEMEHYDRNMKPQPEPKREKEAKKPTIKKPLNAFMLYMKEMRAKVIAE
CTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRTR
EKQQDSNSDPASPKKCRARFGLNQQTDWCGPCRRKKKCIRYLQGEGRCASPVSSDGSAID
SPPSPPDTLQCISSAFPSDKLAAPADSAHREQPDPFPGSAHLQTASCSSRLPARCSSAPA
ESPAYSVASSGT
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgccgcagctgggcagcggcggcggggacgacctgggggccacggacgagatgctggcc
ttcaaggacgagggcgagcaggaggagaagatccccgagaacgccttcacggagcgcgac
ctggccgacctcaagtcctcgctggtgaacgagtcggagggaacgaaacacccagcagcc
tcttcgggccccccgacaggcagaggaatcacctgtcgtagggcaactcttgatggggaa
cttttgattttagcaggtatgaagcatcaggacccagggatgtataaaggatctgcgtat
tctggctaccctttcctaatgctctcagatccttatctgccaaatggatctatgtcacct
ctgtccaacaaagttcctgtcgtgcagccgtcccacggagtccacccgctcaccccactc
atcccttacagcaacgaccatttcagccacggctcccactcgccccatttgcccgccgac
atcaaccagaaacaaggagtgcaccgtccttcccagacgtcagacatccccggtttctac
cccctccctcccggtggagttggacagatcacgccgtcgatgggatggcagagccagtct
gtctatccgctcccgtcatgtggatttagacagccgtattcgtcagcgctttctgctggg
gcttctttctccaggttcactcacccgctgatgctgggctctggcatgcacaccaccggc
atcccgcaccccgccattgtgccccactccggcaagcaagagatggagcactatgaccga
aacatgaaacctcaaccagaaccaaagagagagaaggaagccaagaagcccactatcaag
aagcccctgaacgctttcatgttgtatatgaaagaaatgcgggcgaaagtcattgccgaa
tgcaccctgaaagagagcgccgccatcaaccagatcttgggcagaaggtggcacgcgctg
tcccgggaggagcaggccaagtactacgaactggctcgcaaggaacggcagctccacatg
cagctctaccccggctggtctgccagagacaactacgggaaaaagaagagacgaacacgg
gaaaagcagcaagattccaactcagatcctgcctctcctaagaaatgcagagctcgcttt
ggcctcaaccaacaaacggactggtgcggcccgtgcaggaggaaaaagaagtgcattcgg
tacttacaaggagaaggacgctgtgccagcccagtttcttccgatggaagtgctatagac
tcccctccctctcctccggacacactccaatgcatctcctctgcttttccttcagacaag
cttgcagcccccgctgactccgcacacagagaacagcctgaccccttccctggctccgct
cacctccaaactgcctcctgctcctccagactgcctgccaggtgctcctctgcgcccgca
gagtccccagcctacagcgtggcctccagcgggacatag

DBGET integrated database retrieval system