KEGG   Falco cherrug (Saker falcon): 102050356Help
Entry
102050356         CDS       T02911                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00590  Arachidonic acid metabolism
fch01100  Metabolic pathways
fch04370  VEGF signaling pathway
fch04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102050356 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102050356 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102050356 (PTGS2)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102050356 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 102050356
NCBI-ProteinID: XP_005443369
LinkDB All DBs
Position
Un
AA seq 571 aa AA seqDB search
MTTGLDQYECDCTRTGYYGENCTTPEFFTWLRLTLKPLPNTVHYILTHFKGAWNIINDIP
FLRDAIMRYVLTSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRSLPPVGLDCPTPMGVK
GKKELPDSKVIVEKFLLRKKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTKALGH
GVDLNHIYGETLERQLKLRLLKDGKLKYQMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGRNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKHFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFEIINTASLQKLVCNNVKGCPFTAFHTLNPE
PTEATINVSTSKRAMEDINPTLLLKERSTEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggactggatcagtacgaatgtgactgcacgaggacaggatattatggggaa
aactgtacaacaccggaattcttcacgtggctgaggctaacattgaaacctttgccgaat
actgtccactacatcctcacccacttcaaaggagcctggaatatcatcaatgacattcca
ttcttaagagatgctattatgagatatgtattaacatcgagatcacacttgattgacagt
ccaccaacttacaatagtgattatagttacaaaagctgggaagcttattccaatctttcc
tattacacaagaagccttccaccagtaggacttgactgcccaacacccatgggtgttaaa
ggtaagaaagagcttccagattcgaaagtgattgtggagaagtttttgctgaggaaaaaa
tttattcctgacccacaaggcacaaatgtgatgttcacattctttgcccaacacttcact
catcagttctttaagactgaccacaagaaaggacctggcttcaccaaagctctcggccat
ggggttgacttgaatcatatttacggagagactctggagagacaacttaaactgagactt
ctaaaagatggaaagctaaaataccagatgattgatggagaaatgtatccaccaacagtg
aaggacactcaggcagagatgatctaccctcctcacgtacctgaacacttgcagttttct
gtcgggcaggaggtgtttggtttggtcccgggcttgatgatgtatgctacaatatggctg
agggaacacaaccgggtctgtgacatcctgaaacaggagcatccagagtgggatgatgag
cagctgttccaaactactagactcatactgataggagaaacaatcaagattgttattgag
gactatgtgcagcacttgagtggctaccacttcaaactcaagtttgatcctgaactgctg
ttcaaccagcgatttcaataccagaaccgaattgcagccgaattcaatactctctaccac
tggcacccgcttctgcctgacactttccagatacatgaccaggaatacactttccagcag
ttcctctacaacaactctataatgctggaacatggcctttcccatatggtgaagtctttc
tccaagcaaagtgctggcagggttgctggtgggagaaatgttcctgctgcagtacagaaa
gtagcaaaggcttcaattgaccaaagcagacaaatgagataccagagcttgaatgagtac
aggaaacacttcatgctgaaaccgttcaaatcatttgaagaacttacaggagaaaaagaa
atggcagctgaactggaagagctttatggagacattgatgctatggagctgtacccaggt
cttctcgtagaaaagccacgaccaggtgccatcttcggtgaaacaatggtggagatcgga
gcaccattctctctgaaaggactgatgggaaatgctatctgctcccctgagtactggaaa
cctagcaccttcggtgggaaagtgggcttcgaaataatcaatactgcctccttacagaag
ctcgtctgcaacaacgtgaaaggctgccctttcactgctttccacaccttaaatcctgaa
cccacagaggcaactattaatgttagtacctcaaaaagagcaatggaagatatcaacccc
acactactactgaaagagcgctctactgagttgtaa

DBGET integrated database retrieval system