KEGG   Falco cherrug (Saker falcon): 102050625Help
Entry
102050625         CDS       T02911                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fch00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    102050625 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fch01002]
    102050625 (TMPRSS2)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102050625 (TMPRSS2)
Peptidases [BR:fch01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102050625 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2 Orf78
Motif
Other DBs
NCBI-GeneID: 102050625
NCBI-ProteinID: XP_005438640
LinkDB All DBs
Position
Un
AA seq 484 aa AA seqDB search
MTSTVSPQPYYENHGFQPENVYYARQTAGANPYPQYFSTNAPSVPSYVPRVATHQSSRPV
AHSSRRTCASSVKKTIVVILSILTVICCAIAAFFIWYFVENRCLGSLIECGSSGVCMPPS
QWCDGVSHCPNGEDETRCVRLFGPNFILQVYSPVSKSWYPVCQDDWNDDYGRIACKDMGY
SVDTYYYSRGVATEVGSKSYMKLNTSAGNIDLYKKLYSSDSCASGNVVSLRCVDCGLPTK
NVNIMNRIVGGSGAVPGPWPWQVSLHVHGTHVCGGSIITRQWIVTAAHCVEGRFSDPYSW
RVYAGILNQDEMLLRNGYRVQQIISHPDYDTDSKDNDVALMKLETLLSFTDTVRPVCLPN
PGMMFQPNQQCWISGWGAEYQGGKTSNSLNYVMVPLIEHSRCNSVSIYNGMILPTMICAG
YLGGGVDSCQGDSGGPLVTNKNSVWWLVGDTSWGTGCASPNRPGVYGNMTVFTDWIYKNM
QANR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacctctactgtaagtccacagccatactatgaaaatcatggctttcagccagaaaat
gtctattatgccaggcagacagccggtgctaacccgtatccacagtacttctcaacaaat
gctccgtcagtgccaagctatgtcccaagggttgctacccatcagtcgagtaggccagta
gcacattcgtccaggagaacgtgtgcatcaagtgtaaagaaaaccatagttgtcatatta
tccattttaacagtcatttgttgtgcaattgctgctttcttcatctggtattttgtagag
aatcgttgtcttggctccttaatagagtgtggatcttcaggagtatgcatgccaccctcg
cagtggtgtgatggggtgagccactgccccaacggagaggatgaaacccgctgtgttaga
ctttttggaccaaactttatcctgcaagtttattcacctgtcagcaaatcctggtatcct
gtttgtcaagatgactggaatgatgattatgggaggattgcatgtaaagacatgggctac
agtgtggatacgtattactatagtcgaggagtagcaactgaagtcggctctaagagctac
atgaagctgaacacaagtgctgggaatatagacttgtacaaaaagctgtatagcagtgat
tcctgtgcatcaggaaatgtggtttctctgcgctgtgtagactgtggcctgcccactaag
aacgtgaacattatgaacagaattgtgggtggcagcggagcggtgccaggaccttggccg
tggcaggtcagcctccatgtgcatggcacccatgtctgcgggggctccatcatcacccgt
cagtggatagtgacagcggcgcactgcgtggaaggacgattttctgacccgtacagctgg
agggtttatgctgggattctgaatcaggatgagatgctcttaagaaacggatacagagtg
caacagataatttcccatccagattatgatacagattcgaaagacaatgatgttgccctt
atgaagttagaaacactgctgagttttactgatactgtacggccagtttgtctgcctaat
ccaggaatgatgttccagcctaatcagcagtgctggatatctgggtggggagcagagtac
caaggaggtaaaacatcaaatagcttaaattatgttatggtgcccttaatagaacattct
aggtgtaattctgtctctatctataatggcatgattttgcctacaatgatctgtgctgga
tatctaggaggaggagttgattcctgtcagggtgacagtggaggtccgctagtaactaac
aaaaactctgtgtggtggctggttggagataccagctggggaactggctgtgctagtccc
aatagacctggagtctatgggaatatgactgtgtttacagattggatttataaaaatatg
caggcaaacagatga

DBGET integrated database retrieval system