KEGG   Falco cherrug (Saker falcon): 102050638
Entry
102050638         CDS       T02911                                 

Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 3-like
  KO
K06083  WAS protein family, member 3
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102050638
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102050638
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102050638
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     102050638
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 102050638
NCBI-ProteinID: XP_014137645
LinkDB
Position
Unknown
AA seq 417 aa
MPLVKRNIEPRHLCRGALPEGVTSELECVTNSTLAAIIKQLGSLSRHAEDIFGELFNEAN
SFYMRMNSLQERVDLLVIKVTQLDSTVEEVSLQDINMRKAFKSSTVQNQQVVSRNSIPNP
VMEMYQRCDKPPPLNILTPYRDDKKDGLKFYTDPSYFFNLWKEKMLQATEDKRKEKRRQK
EQRLVEDSTREVKKVRKARNRRLEWNMMAYDKEFRPDNRFSPSPYHMASSEGSLSPDNRS
YASDAADHSYPASPNHPAQLLAPASHLAPAEHKEGVLAAAPPQEHVYRPAAGSRQNSLNR
LQQPHVPQPPEAILNGPRPHLVKDYGASPEHSASPPAPAVETRKAQIPLMPMSDARSDLL
AAVRRGIQLRKVQEQWEQEAKKEPVGNDVATILSRRIAVEYSESDDDSELDDNEWSD
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgccgctggtgaagaggaatatcgagccccggcatctatgccggggggctcttcccgag
ggggtaacgagtgagctggagtgtgtcaccaacagcacactggctgccatcatcaagcag
ctgggcagcctcagcaggcacgccgaggacatcttcggcgagctgttcaacgaagccaac
agcttctacatgcggatgaactcactgcaggagagagtggacctgctggtcatcaaggtg
acacagctggactccaccgtggaggaagtttcactgcaggacatcaacatgcggaaagcc
ttcaagagctccacggtgcagaaccagcaggtggtgtctcgcaactccatccccaatccg
gtgatggagatgtaccagcgctgcgacaagcccccgccgctcaacatcctcacgccctac
agggatgacaaaaaggatggcctcaaattctacactgacccctcctacttcttcaactta
tggaaggagaaaatgttgcaggcgacggaagataagagaaaggagaagcgcaggcagaag
gagcagcggctggtggaggactccactcgggaggtgaagaaagtgaggaaagcccgcaac
cggcgcctggagtggaacatgatggcgtatgataaagagttccgacccgataacaggttc
tcaccatccccctatcacatggcgtcatcggaaggatcactgtccccagataatagatct
tacgcgtcggatgcagccgaccactcgtacccggcgagccccaaccaccccgcacagctg
ctggccccagcatcccacctggccccagcggagcacaaggagggggtgctggcggctgcc
cccccccaggagcacgtctatcgcccggcagcgggcagccggcagaacagcctcaaccgc
ctccagcagccccacgtgccgcagcccccagaggctatcctcaatgggccgagacctcac
ttagtcaaggattacggcgcctctccggagcactcggcatcacccccagcacccgccgtg
gagacccggaaggcgcagatcccactgatgcccatgagcgatgcccggagcgacctgctg
gcagccgttcgcaggggaattcaactccggaaagtccaggagcaatgggaacaagaggcc
aaaaaagaacccgtgggcaatgacgtggcgacgatcctgtcccgccggatcgcagtggag
tacagcgagtccgacgacgactccgagctggatgataacgagtggtcagactga

KEGG   Falco cherrug (Saker falcon): 102052077
Entry
102052077         CDS       T02911                                 

Gene name
WASF2
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 2
  KO
K05748  WAS protein family, member 2
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102052077 (WASF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102052077 (WASF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102052077 (WASF2)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     102052077 (WASF2)
SSDB
Motif
Pfam: WH2 WASH_WAHD
Other DBs
NCBI-GeneID: 102052077
NCBI-ProteinID: XP_005433138
LinkDB
Position
Unknown
AA seq 501 aa
MPLVTRNIEPRHLCRQTLPSVRSELECMTNITLANVIRQLGSLSKFAEDIFGELFTQANT
FASRVSVLVERVDRLQVKVTQLDPKEEEVSLQGINTRKAFKSSTTQDQKLFDRDSLPVPV
LETYRTCNTPPPLNILSPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKENPNRGNVNPRKIKTRKEEWEKLKMGQEFVESKDKHGPAGYPSNMVYQNGSIGSNES
MDVNCYPPPPQTDSIVPPPPSFPDDSLPPPPVEFSYPVDNQRGSGSGGTKRSSLVSPSHP
PPAPPIGSPSAARPGFAPPPAPPPPPPSVIGSPPPPPPPLGFSTPGTPPPPSPPSFPPHP
EFAAPPPPPPPPAVDFSNVLPPPLPQLGSGSAPPPPPPPPPPGPPPLSSSGLDGPPPPPP
PSDTSSSKPKSSLPAVSDARSDLLSAIRQGFQLRKVEEQREQEKRDVVGNDVATILSRRI
AVEYSDSEDDSSEFDEDEWSD
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacattgagccaaggcacctgtgccgtcagacgttgcctagc
gttcgaagcgagctggaatgcatgaccaacatcaccctggcaaatgtcattcgacagctg
ggcagcctgagtaaatttgcagaagacatatttggagagttgtttactcaagccaacacc
tttgcctcacgggtgagcgttctagtcgagagagttgaccgcttgcaagtcaaagtcact
cagctggatcccaaagaggaagaagtctccctacaaggcattaacaccaggaaggccttc
aaaagctccactactcaggaccagaagctcttcgacagagattctctccccgtgcctgtc
cttgaaacctataggacctgtaatactcctccacctctcaacattctctcaccttacagg
gatgatggcaaagaggcgcttaaattctacacagatccttcatatttcttcgacctttgg
aaagagaaaatgcttcaggacaccaaggatattatgaaagagaagcggaaacacaggaaa
gagaaaaaagagaatccgaaccgaggaaatgtgaatccgcggaaaatcaaaacccggaaa
gaagagtgggagaagctgaaaatgggacaagaatttgttgagtcaaaggacaaacatggc
cctgctgggtacccctctaacatggtgtatcagaatggcagcatcggttcaaacgaaagc
atggacgtgaactgctacccgccaccgccgcagactgactctattgtgccaccacctcct
tcgttcccagatgacagcctgcctccacccccggtggaatttagctatcctgtagacaac
caaagaggttctggttctggagggaccaaacgatccagcctggttagcccaagccacccg
ccaccagctcctccgatcggatccccctcagcggccaggccgggctttgctcctcctccg
gcgccacctccgccaccaccatcagtgataggaagccccccgcctccaccgccccccttg
ggcttctcgaccccgggaaccccaccaccaccctcacccccttctttccctcctcaccct
gagtttgctgccccgccacccccaccgccccctccagcagtcgatttttccaacgtgctc
ccacctccgctgcctcagctgggcagtgggagtgcgccgcctcccccgccaccaccacct
cctccaggcccaccacctttgtcttccagtggcctggatggtcccccaccccctcctcca
ccctcagacacctcctcctccaagcccaagtcatccctgcctgcggttagcgatgccagg
agtgatctactttcagctattcgtcaaggcttccagctccgcaaggtggaggagcagcgg
gaacaggagaagcgggacgttgtaggcaatgatgtggcaacgatcctgtcacgccgcatc
gctgtggagtacagcgactctgaggatgactcttcggagttcgatgaggacgaatggtcg
gattaa

KEGG   Falco cherrug (Saker falcon): 102056861
Entry
102056861         CDS       T02911                                 

Gene name
WASF3
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 3 isoform X1
  KO
K06083  WAS protein family, member 3
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102056861 (WASF3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102056861 (WASF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102056861 (WASF3)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     102056861 (WASF3)
SSDB
Motif
Pfam: WH2 ChaB
Other DBs
NCBI-GeneID: 102056861
NCBI-ProteinID: XP_005446514
LinkDB
Position
Unknown
AA seq 502 aa
MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
SFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTIQDQQVVSKNSIPNP
VADIYNQSDKPPPLNILSPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRS
HASDVTDYSYPATPNHSLHQQIAMPSYGTGDGPQYMAASQSHEHEYRPPSTTVRHATLNR
PQQPPPPPPQPSDGQHSSVPVVPAEYGMLPAQMVDYYNPAGPPPPPPPPMIPSAQTAFVS
PLQLPVPPSHSGLVTGSTYAATHPPPSSGLVVTAPPPPGPPPPPPGPPAAGSSLSSSPMH
APPVTEAKRHEPAQPPVSDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSR
RIAVEYSDSDDDSEFDENDWSD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcctttggtgaaaaggaacattgaaccacggcatctctgccgaggagctctgccagag
ggaattacaagtgaactggaatgtgtaacaaatagtacccttgctgctatcatacgccag
ctaagcagcttaagcaaacatgctgaagacatatttggtgaattgtttaatgaggccaac
agcttctacatcagagcaaattcccttcaagacagaatcgatcgccttgctgtcaaagtt
acccagctggattcaacagtagaagaggtatcattacaggatatcaacatgaaaaaagca
ttcaaaagctcaactattcaagatcagcaggtagtttcaaagaacagcattcctaaccca
gtggcggatatttataatcagagtgacaaaccaccacctctgaatattctttcaccttat
agggatgataagaaggatggattgaagttctatactgatccttcatatttttttgatctt
tggaaagaaaaaatgttacaagatactgaagataagcgaaaagaaaagaggagacaaaag
gagcaaaagcgtatagatggcaccacccgtgaggtgaaaaaggttagaaaagccaggaac
agacgccaggagtggaatatgatggcatatgacaaagagcttagacctgacaacaggttg
tctcaaagtgtgtaccatggagcatcttccgagggatcactgtccccagatactaggtcc
catgcatctgatgttacagattattcttatcctgctactccgaatcattccctccatcag
cagatagcaatgccttcatatggaacaggagatggtccgcagtacatggcagcatcccaa
agccatgagcatgaatacagaccaccttccaccactgtacgacatgctactttaaacaga
cctcaacaaccacctccacctccaccccagccttcagatggccaacatagctcagtacct
gtggtaccagcagaatatgggatgcttccagctcagatggtggattattacaatcctgcc
ggtcctccccctcctcctcctccccctatgattccttcagcacaaactgcatttgttagt
ccccttcagcttcctgtgccgccttcccattctggactggtgactggctctacatacgca
gctactcatcctcctccttctagtgggctcgttgtcactgctcctcctcctcctggtccc
cctcctccccctccaggccctcctgcagcaggttcgtccctctcttcctccccaatgcat
gcccctccagttacagaggcaaaacgtcacgagcctgcgcagccgccagtaagtgatgca
cggagcgatcttcttgctgccattcgaatgggaatccagctgaaaaaggtacaggagcaa
cgtgagcaagaagcaaagcgagagcctgttggaaacgatgtggcaaccatcctttcaaga
cgcattgccgtggaatacagtgattctgatgacgattcagagtttgacgagaacgattgg
tcagattga

KEGG   Falco cherrug (Saker falcon): 102058978
Entry
102058978         CDS       T02911                                 

Gene name
WASF1
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 1 isoform X1
  KO
K05753  WAS protein family, member 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102058978 (WASF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102058978 (WASF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102058978 (WASF1)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     102058978 (WASF1)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 102058978
NCBI-ProteinID: XP_005445772
LinkDB
Position
Unknown
AA seq 562 aa
MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH
SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP
LQETYDICEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK
QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFESRSQ
AYVDHMDGSYSLSALPYSQMSELLNRAEERVLVRPHEPPPPPPMHGAGDVKPVPPCVSST
TGLVENRPQSPATGRTPVFVSPAPPPPPPPPLPSALSTSSLRAAMTSTPPPPVPPPPPPP
TAALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLAQPSPPVTRAAQVCEAVPVHPVPPQA
EVQGLPPPPPPPPLPPPGIRPSSPVTVAALSHPPSVLHPPPTTVVPGPHAPLMPPSPPSQ
VIPAPEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSR
RIAVEYSDSEDDSEFDEVDWLE
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgccactggtaaaaaggaacatagaccccaggcacctgtgccacacagctctgccgcga
ggtatcaagaatgaattggaatgtgtcaccaatatctccttggcaaatataatcagacaa
ctgagtagcctaagtaaatatgctgaagatatatttggtgaacttttcaatgaagcacac
agtttctcatttagagtcaactccttacaggaacgtgtagatcgcttatctgtcagtgtt
acacaactcgatccaaaggaagaagaattgtcactgcaggacattacaatgaggaaagct
ttccggagttccacaattcaagatcaacagctatttgaccgcaaaactctgcctattcct
ttgcaagaaacttatgatatttgtgaacagcctcctccgcttaacattctcaccccttac
agggatgatggaaaagagggtctgaagttttataccaatccttcatacttctttgatctg
tggaaggaaaaaatgctgcaggacaccgaggacaaaagaaaagagaagaggaagcagaag
cagaaaaatctagatcgccctcatgaaccagaaaaagtgccaagggcacctcatgacaga
cggagagagtggcagaagttagcccaaggtccagagctcgcagaagatgatgctaacctc
ttacataagcacattgaagttgctaatggcccagcttcacattttgaatcaagatctcaa
gcatatgtggaccatatggatggatcatactcactttctgcattaccctatagccagatg
tctgagcttctgaacagagccgaggagcgagtgttggtcagaccacatgaaccaccaccg
ccacctccaatgcatggagcaggagatgtgaaacctgtgcctccttgtgttagttctact
actggcttggtagaaaatcgtcctcagtcgccagcaacaggcagaacaccagtgtttgtg
agccccgctcctcctcctccaccaccaccacctcttccatctgccttgtcaacttcatca
ttaagagctgcaatgacttccaccccaccacccccagtcccacctccaccaccccctcct
acagctgctctgcaagccccagctgtgccacctccaccagctcctctccagatagctcct
ggagtcctacatccagctccacctccaattgctcctcccctagcacaaccctcaccccct
gtcactagagctgcccaagtgtgtgaagctgtacctgttcaccccgttcctccacaagct
gaagtacagggacttcctccaccacccccacctcctcccttgccacctcctggcattcga
ccctcctctcctgtcacagttgcagccctttctcaccctccttctgttctgcaccctcct
cccacaaccgttgtccctggccctcatgccccgctgatgcctccatctccaccatcccaa
gtgattcctgctcctgaacccaaacgccatccttcaactcttcctgtaatcagtgatgct
agaagtgttctgctggaagcaatacggaaaggtattcagctacgcaaggttgaagagcaa
cgtgaacaagaagctaaacacgagcgtattgagaatgatgttgctactatactttctcgt
cgcattgctgtggaatatagcgactcagaagatgattcagaatttgatgaagtggattgg
ttagagtaa

DBGET integrated database retrieval system