KEGG   Falco cherrug (Saker falcon): 102050734
Entry
102050734         CDS       T02911                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102050734 (CACNA1E)
   04020 Calcium signaling pathway
    102050734 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fch04040]
    102050734 (CACNA1E)
Ion channels [BR:fch04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102050734 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 102050734
NCBI-ProteinID: XP_027656384
LinkDB
Position
Unknown
AA seq 2399 aa
MLGFGAYSVSAPAPGRAAELDAASPRYVLALPEEETWRKHRLGLMQTTQSCNLLEPESLA
EALVSRAASFDALYESRSRDADAGTETSSTLDLGLGQYVPVSPDVIKRRRGGLIEQRDII
KAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGSGDGGSDQNRSRQGPPAPAGGTPGAFK
QTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATII
ANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGW
NVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVP
LLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECR
EWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSF
FVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENK
NSGTSALEVLRRATIKRNRTDAMNRDSSDEHCVDISSVGERRLAQRRPLHPTLGNPLSHS
GLKGARVDGASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLT
HFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTS
FGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLF
GGRFNFIDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIV
LTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPA
IERERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKKPGDGVALE
KCTEEQGGKGERPPAEGPEQPAPGANPGGGEDRRSPSPRAKRDKEPWHQKSCHGNCEPGE
QDGAGGSIEDRARMRQSQRRSRHRRARMEGKEPAGALGSRSASQEMGLEEASPTEGMQDG
DRRGDVAAAEALIQGEPEASGESIRTNGVPAGNAELVGTTEEGSAQRGGPEPPQGKTGSL
MEQDCSSLDTSEQALLEASHTVSRSEPDLSSITPNTEKAMESTTIMIDVHDSTVVQISNK
TDGEASPLKEAESKEDEEEMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVN
LRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLI
LQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKR
LPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIG
NYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGP
SRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAI
SAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALK
YLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFN
MSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGN
IRLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNEN
ERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEY
DRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMA
LIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAA
MMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSS
RSGFPSLSPLSPQEIFQLACMDPAHGQFQEHQSLEPEVREFQRVQPSNRGSYLPVDTQDH
AVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRTNSSWLDEFSMERSSDNTYKSRRR
SYHSSLQLSARRLNTDSGHRSDGHRSGGRERGRSKERKHLLSPDISRCNSEERSPQAHDE
SPERRRESRSPSEGRSQTPNRQGMGSLSESSIPSISDTSTPRRGRRQLPPVPPMXSEGGS
PLLSSTLEPNAAGLTESSSSPAGKQSRQSTPQRYISEPYLALHDDSHASDCGEEETLTFE
AAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGAGQGVMCGASIDVLSDTEEDDKC
NT seq 7200 nt   +upstreamnt  +downstreamnt
atgctgggattcggcgcgtactctgtcagcgccccagcgccgggcagggcggctgagctg
gacgctgcctccccccgttacgtcctggccctgccagaggaggagacctggcgcaagcac
cggctggggctgatgcagaccacccagtcctgcaacctgctggagcccgagagcctggcc
gaggccctggtctcgcgcgctgccagcttcgatgccctctacgagtcccggtctcgggat
gccgatgccggcacggagaccagcagcaccttggacctggggctcggccagtatgtccct
gtgagcccggacgttatcaagcgccggcggggcgggctgatcgagcagagggacattatc
aaggcacatgaggcgcacaagatgcagagcacgccgcaggcgcggaggaaggagtgggag
atggctcgttttggggaggcggtggccggcaggctgggctccggagacgggggctccgac
cagaaccggagccggcaaggaccccctgcccctgcaggagggaccccgggagccttcaag
caaaccaaagcgcagagagcccggactatggctctgtacaaccccatacctgtccggcag
aactgcttcaccgtcaacagatcactcttcctctttggggaagagaacatagtcaggaaa
tatgctaagaagctcatcgactggcctcccttcgaatacatgatcttggcgaccatcatt
gccaactgcattgtgctggcgctcgagcagcacctccctgaggatgacaagacgcccatg
tcacggagattagagaagacggagccctacttcatcgggattttctgcttcgaggctggg
attaagattgtggctctggggtttgttttccacaagggctcatacctgcgcaatggctgg
aacgtcatggacttcatcgtggtcctcagtggcatccttgccaccgctgggacgcacttc
aacacccacgtggacctgcggacgctgcgggctgtgcgtgtgctcagacctctgaagctc
gtctcaggcattcccagcctgcagattgtgctgaaatccatcatgaaggccatggtgcct
ctcctccagattggcttgctgctcttttttgctatcctcatgtttgctattatcggcctg
gagttctacagcgggaagctgcaccgagcctgctatacaaacaattcaggtgaactagag
gagctggaccccccccatccatgcggggtgcagggttgccccccaggatacgaatgccgg
gagtggatcggtcccaacgatgggatcacgcagtttgacaacatcctctttgctgtgttg
accgtcttccagtgcatcaccatggaagggtggaccacagtcctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcatccccctcatcatcattggatccttc
tttgtcctcaaccttgtcctgggagtgctgtcgggggagtttgccaaagagcgtgagcgg
gtggagaaccgccgagccttcatgaagctgcggcgccagcagcagatcgagcgggagctc
aacggctaccgagcctggatagacaaagcagaggaagtcatgctagctgaagagaacaaa
aattctgggacctcagccttagaagtgctcaggagagccaccatcaaaaggaaccggaca
gatgccatgaaccgtgactcgagtgatgagcactgtgtcgatatctcctccgtgggcgag
cggaggctggcgcagagaagacctcttcatccaaccttgggtaaccccttgagtcactct
ggcctcaaaggcgccagagtggacggtgcctcctacttacggcacaaggagcgactcctg
cgcatctctgttcgccacatggtgaaatcccaggtcttctactggatcgtcttgagcctg
gtggctctcaacactgcctgtgtggccatcgtccatcataaccagccagcctggctcacc
cactttctctactatgcagagttcctgtttcttgggctcttcctcctggagatgtcctta
aagatgtacgggatggggccacgcctttacttccattcttccttcaactgctttgactgt
ggggtcacggtgggaagcatctttgaagtggtttgggctatcttcagaccaggaacgtct
tttgggatcagtgtcctacgagcccttcgtctcctgcgaatatttaaaataaccaagtac
tgggcatccctgaggaatttggtggtctcgctgatgagctccatgaagtctattatcagc
ctgctcttcctcctcttcctcttcattgtagtctttgccctgctgggaatgcagctgttt
ggaggcaggtttaacttcatcgatgggacaccatcagccaactttgacactttccccgcg
gccatcatgacagtgttccagatcctgacgggtgaggactggaatgaggtgatgtacaac
ggcatccgctcccagggaggcgttcgctcgggcatgtggtcctccatctatttcatcgtc
ctcaccttgtttggaaactatactctgctgaatgtgttcttggccattgcggtggacaac
ctggccaacgctcaggagctcaccaaggatgagcaggaggaagaggaggcctttaaccag
aagcacgcccttcagaaagccaaagaagtcagccccatgtctgccccaaacatgcctgct
atcgagcgggagcgtcgccggcggcaccacatgtcggtgtgggagcagcgcaccagccag
ctgcgccggcacatgcagatgtccagccaggagggcatcaacaaggatgagccgcccctc
atcaacccccatgccagcatcttccgcaggaagaaaccgggcgatggcgttgccctggag
aaatgcactgaggagcagggcggcaagggcgagcggccaccggctgagggacctgagcag
ccagccccgggagccaaccctggtggtggtgaggacaggaggagcccatcaccccgggcc
aagcgagacaaggagccatggcaccagaaatcgtgccatgggaactgtgagccaggcgag
caggatggggcaggaggcagcatcgaggatagggccaggatgaggcaaagccagcggcgc
agccggcaccgcagagcccggatggaggggaaggagccggctggtgccctggggagccgc
tcggccagccaggagatgggtctggaggaggccagccccacggaggggatgcaggatggg
gaccggcgtggggacgtggctgcagcggaggcactgattcagggggagccagaggcgagc
ggagagtccatcaggacaaacggggtccctgctggcaatgcagagctcgttgggaccact
gaggaggggagtgcccagcgagggggacctgagcccccccaggggaagacaggcagcctg
atggaacaggactgtagcagcctggacaccagtgagcaagcactgctagaggccagccac
accgtcagccggagcgagcccgacctctcttccatcacccccaacactgagaaggccatg
gagagcaccaccatcatgatcgatgtccacgactccactgtggtacagattagcaacaag
acagatggcgaagccagccccttaaaggaggctgagagcaaagaggacgaggaggagatg
gagaagaagaagcggaagaaggaaaaaagtgagacgggcaaagcgatggtgccgcacagc
tccatgttcatcttcagcaccacaaacccggtgcggagggcttgccactacattgtgaac
ctgcgttacttcgagatgtgcatcctcctggtgatcgccgccagcagcatcgcccttgcg
gcggaggatcccgtcctcaccaactccgaccgcaataaagtcctgaggtattttgactat
gtcttcactggcgtcttcacctttgagatggttatcaagatgattgatcagggcttgatc
ctgcaggatggctcctacttccgagacctctggaacatcctggattttatcgtggtggtg
ggagcgctggtggcctttgccttggcaaatgctttggggaccaacaagggccgggatatc
aagaccatcaagtctctccgtgtgctacgggtcctgaggcccctgaaaaccatcaagcga
ctgcccaagctgaaggctgtcttcgactgtgtcgtgacttccctcaaaaatgtcttcaac
atcctcatcgtctacaagctcttcatgttcatctttgctgtcatcgccgtccagctcttc
aaggggaagtttttctactgcactgacagctctaaggacacggagaaggactgcataggg
aactacgtggaccatgagaagaacaagatggaggtgaagtgccgggaatggaaacgccat
gagtttcactacgacaatatcatctgggctttgctcaccctgttcacagtctccaccggc
gagggttggccccaggtgctgcagcattcggtggacgtaactgaggaggaccgcggccct
agccgcagcaaccgcatggagatgtccattttttatgtcgtctattttgtggtctttcct
ttcttctttgtcaacatttttgtggctctcatcatcattacgttccaagagcaaggagac
aaaatgatggaggagtgcagtctggagaagaacgagagggcctgtatcgattttgccatc
agtgccaagcccctcacgcggtacatgccccagaaccggcacaccttccagtaccgggtc
tggcactttgtggtctccccatccttcgagtacaccatcatggccatgatagcgttgaac
accgtggtgctgatgatgaagtactactctgctccatacacctacgagctggccctgaag
tacctgaacatcgcgttcaccatggtgttctccttggagtgcgtcctcaagatcatcgct
ttcggcttcctgaactacttccgggacacctggaacatctttgacttcatcaccgtcatt
ggcagcattacggagatcatcctgacggacaccaagctggtgaacaccagcagcttcaac
atgagcttcctgaagctcttccgggctgctcgactcatcaaattgctgcgccagggttac
accatccgtatcctgctctggaccttcgtgcagtccttcaaggccctcccctatgtctgc
ctcttgatcgccatgctcttcttcatctacgcgatcattgggatgcaggtttttggcaat
atcagactagatgaggaaagccacattaaccggcacaacaacttccgcagctttttgggc
tccctcatgcttctcttcaggagtgccacaggagaggcatggcaggagatcatgctgtcc
tgcctggagggcaaaggctgtgagcccgacacgacggcgacgtctgggcagaacgagaat
gagcgctgtggcactgacctggcctacgtttacttcgtctccttcatcttcttctgctct
ttcctgatgctcaacctgtttgtggcagtcatcatggacaattttgaatacctgactcgg
gattcctccatcctgggacctcaccatctagatgagtttgttcggatctgggcagagtat
gacagagcagcgtgtggccgaatccattacactgagatgtatgaaatgctgactcttatg
tcaccaccgctaggcctcggcaagagatgtccttccaaagtggcctataagagactggtg
ctgatgaacatgcccgtggccgaggacatgacggtccattttacctccaccttgatggcg
ctgatacgcacagccttggacatcaaaattgccaaaggtggtgcagattggcagcagtta
gactctgaacttcaaaaggagatcctgaccatttggcctcacctgtcccagaagatgctt
gacctgttggtacccatgccaaaaacctctgacctgactgttggcaaaatatatgcagcc
atgatgatcatggattactacaagcagagcaaagcgaagaagcagcggcagcagctggag
gagcagaaaaatgcccccatgttccagcgcatggagccatcctccttgccgcaggaaatc
atctcgaacgcgaaggctctgccttacctccagcaagacaccctctcgggcctgagcagc
cgaagtgggttcccctccctgagcccactctcaccacaggagatcttccagctggcgtgc
atggatccggcccacgggcagttccaggagcaccagtctttggagccagaggttagggag
tttcaaagagtgcagccctctaaccgtggcagctaccttcccgtggacactcaggaccat
gctgtctctgggagggcctcctccatgcctcgtctcactgtggatccccaggtggtgaca
gacaccagctcgatgcgacgatcgttttccaccatccgggacaagcgcaccaacagctcc
tggctggacgagttctccatggagcgcagcagcgacaacacctacaagtcccgccggcgc
agctaccactcctcactccagctctccgcccggcgcctcaacactgactcgggccaccgg
tccgacgggcatcgctcaggcggcagggagcggggccgatccaaagagcgcaagcacttg
ctgtcccccgatatctcccgctgcaactctgaagagaggagtccccaggcacacgacgag
tcgccagagcggcggcgcgagtcccggtcacccagcgaaggcaggtcccagacacccaac
aggcagggaatgggctccctgagtgaaagctccatcccctccatctcggacaccagcacc
ccccggcgaggccgccgccagctcccgccggtcccgccgatgnagagcgagggggggtct
ccgcttctctcctccaccctggagcccaacgccgccggcctgaccgagtcttccagctcc
ccggcagggaagcagagccgacagtccaccccgcaacgctacatctcggagccctacctg
gccctgcacgacgactcgcatgcctcagactgcggtgaggaggagacgctcacttttgag
gctgccgtcgccaccagcctcggccgctccaacaccatcggctcagccccgccgctgcgg
cacagctggcagatgcccaacgggcactaccggcggcggaggcgaggggcagggcagggc
gtgatgtgcggggccagcatcgatgtgctcagcgacaccgaggaagatgacaagtgctag

DBGET integrated database retrieval system