KEGG   Falco cherrug (Saker falcon): 102050787
Entry
102050787         CDS       T02911                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04145  Phagosome
fch04210  Apoptosis
fch04510  Focal adhesion
fch04520  Adherens junction
fch04530  Tight junction
fch04810  Regulation of actin cytoskeleton
fch05132  Salmonella infection
fch05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102050787 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    102050787 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102050787 (ACTB)
   04520 Adherens junction
    102050787 (ACTB)
   04530 Tight junction
    102050787 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102050787 (ACTB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102050787 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    102050787 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fch03021]
    102050787 (ACTB)
   03019 Messenger RNA biogenesis [BR:fch03019]
    102050787 (ACTB)
   03036 Chromosome and associated proteins [BR:fch03036]
    102050787 (ACTB)
   03029 Mitochondrial biogenesis [BR:fch03029]
    102050787 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102050787 (ACTB)
   04147 Exosome [BR:fch04147]
    102050787 (ACTB)
Transcription machinery [BR:fch03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     102050787 (ACTB)
Messenger RNA biogenesis [BR:fch03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102050787 (ACTB)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     102050787 (ACTB)
    NuA4 complex
     102050787 (ACTB)
  Chromatin remodeling factors
   BAF complex
    102050787 (ACTB)
   PBAF complex
    102050787 (ACTB)
   SWR1 complex
    102050787 (ACTB)
Mitochondrial biogenesis [BR:fch03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    102050787 (ACTB)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     102050787 (ACTB)
Exosome [BR:fch04147]
 Exosomal proteins
  Proteins found in most exosomes
   102050787 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 102050787
NCBI-ProteinID: XP_005435706
LinkDB
Position
Unknown
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgacgatattgctgcgctcgttgttgacaatggttccggtatgtgcaaggccggt
tttgccggggacgatgctccccgtgctgtcttcccatccatcgtgggtcgccccagacat
cagggtgtgatggttggtatgggccagaaagatagctatgttggtgatgaagcccagagc
aaaagaggtatcctgaccctgaagtaccccattgaacatggtattgtcaccaactgggat
gacatggagaagatctggcaccacactttctacaatgagctgagagtagcccctgaggag
caccctgtgctgctcacagaggctcccctgaaccccaaagccaacagagaaaagatgaca
cagatcatgtttgagaccttcaacaccccagccatgtatgtagccatccaggctgtgttg
tccctgtatgcctctggtcgtaccactggtattgtgatggactctggtgatggtgttacc
cacactgtgcccatctatgaaggttatgccctcccccatgccattctccgtctggatctg
gctggccgtgacctgacggactacctcatgaagatcctgacagagagaggctacagcttc
accaccacagccgagagagaaattgtgcgtgacatcaaggagaagctgtgctatgttgcc
ctggattttgagcaggagatggccacagctgcctctagctcttctctggagaagagctat
gaactccccgatggccaggtcatcaccattggcaatgagaggttcaggtgccccgaggcc
ctcttccagccgtcttttctgggtatggagtcctgtggtatccatgaaactaccttcaac
tccatcatgaagtgcgatgtggatatccgtaaggacctgtatgccaacacagtgctgtct
ggtggtaccacaatgtaccctggcattgctgacaggatgcagaaggagatcacagccctg
gcacccagcacgatgaaaatcaagatcattgccccacctgagcgcaagtactctgtctgg
atcggaggctccatcctggcctccctgtccaccttccagcagatgtggatcagcaagcag
gaatatgatgaatccggaccctccattgtccaccgcaaatgcttctaa

KEGG   Falco cherrug (Saker falcon): 102056825
Entry
102056825         CDS       T02911                                 

Definition
(RefSeq) actin, cytoplasmic type 5
  KO
K05692  actin beta/gamma 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04145  Phagosome
fch04210  Apoptosis
fch04510  Focal adhesion
fch04520  Adherens junction
fch04530  Tight junction
fch04810  Regulation of actin cytoskeleton
fch05132  Salmonella infection
fch05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102056825
  09143 Cell growth and death
   04210 Apoptosis
    102056825
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102056825
   04520 Adherens junction
    102056825
   04530 Tight junction
    102056825
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102056825
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102056825
  09172 Infectious disease: viral
   05164 Influenza A
    102056825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fch03021]
    102056825
   03019 Messenger RNA biogenesis [BR:fch03019]
    102056825
   03036 Chromosome and associated proteins [BR:fch03036]
    102056825
   03029 Mitochondrial biogenesis [BR:fch03029]
    102056825
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102056825
   04147 Exosome [BR:fch04147]
    102056825
Transcription machinery [BR:fch03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     102056825
Messenger RNA biogenesis [BR:fch03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102056825
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     102056825
    NuA4 complex
     102056825
  Chromatin remodeling factors
   BAF complex
    102056825
   PBAF complex
    102056825
   SWR1 complex
    102056825
Mitochondrial biogenesis [BR:fch03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    102056825
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     102056825
Exosome [BR:fch04147]
 Exosomal proteins
  Proteins found in most exosomes
   102056825
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 102056825
NCBI-ProteinID: XP_005437512
LinkDB
Position
Unknown
AA seq 376 aa
MADEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS
YELPDGQVITIGNERFRCPEAIFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPSIVHRKCF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcggatgaagagattgctgcccttgttgtggacaatggctctggcatgtgcaaggca
ggttttgcaggggatgatgccccccgtgcagtctttccctccattgtggggcgtccccgg
catcagggtgtcatggtgggcatggggcagaaggacagctatgtgggggatgaagcccag
agcaagaggggcatcctcactctgaagtatcccattgagcatggcatcgtcaccaactgg
gatgacatggagaagatatggcaccataccttctacaatgagctgcgtgttgccccagag
gagcaccctgtcctgctcactgaggcccccctgaaccctaaggccaaccgggagaagatg
acccagatcatgtttgagaccttcaacaccccagctatgtacgtagccatccaggctgtg
ctgtccctctatgcctctggccgcaccaccggtatagtcatggactctggggatggtgtc
acccacactgtgcccatctatgaaggctatgcgctgccccatgctatcctgcgtctagac
ttggctggccgtgacctgaccgactacctcatgaagatcctcacggagcggggctacagc
ttcaccaccacagctgagagagagattgtgcgggacatcaaggagaagctctgctatgtt
gctctggactttgagcaggagatggccacagctgcctcttcctcctccctggagaaaagc
tatgagctgcctgatgggcaggtgatcactattgggaatgagcgtttccgatgccctgag
gccatattccagccctctttcctgggcatggagtcctgcggcatccacgagaccactttc
aattcaatcatgaagtgtgatgtggacatcaggaaggacctgtatgccaacaccgtgctg
tctgggggtaccaccatgtaccctggtattgctgacagaatgcagaaggaaatcacggcc
ctggcacccagcaccatgaagataaagattatcgccccaccggagcgtaaatactctgtc
tggattggtggctccatcctggcatctctctccaccttccagcagatgtggatcagcaag
caggagtatgatgagtctggcccttccattgtccatcgcaagtgcttctaa

DBGET integrated database retrieval system