KEGG   Falco cherrug (Saker falcon): 102051071Help
Entry
102051071         CDS       T02911                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00052  Galactose metabolism
fch00500  Starch and sucrose metabolism
fch01100  Metabolic pathways
fch04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102051071 (GAA)
   00500 Starch and sucrose metabolism
    102051071 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102051071 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102051071 (GAA)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102051071 (GAA)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102051071 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102051071
NCBI-ProteinID: XP_014133125
LinkDB All DBs
Position
Un
AA seq 761 aa AA seqDB search
TDTRLHLQLRDPARPRYEVPLAAPRVGGRAATTLYGVQVNQDPFGLVVYRQHGGQVLVNT
TVAPLFFADQFLQISTSLPSHFISGLGEHLTPLVLDTAWTRVTLWNRDMAPTAQVNLYGS
HPFYLGMEDGGLAHGVFLLNSNAMDVLLQPSPALTWRTTGGILDFYVFLGPDPKSVVRQY
LDVVGFPFMPPYWGLGFHLCRWGYSSTDITRQVVDNMTAARFPLDVQWNDMDYMDAKRDF
TFNKKSFKDYPEMVRDFHRRGLRYIMIVDPGISSSGPPGTYKPYDEGLKRGVFIQNATGQ
PLIGKVWPGPTAFPDFTNPETHEWWHDMVKDFHNQVPFDGMWIDMNEPSNFVEGSQDGCP
NNSLEQPPYVPGVFGGRLQAGTICASSQQYLSSHYNLHSLYGLTEAIASHDALLRVRGKR
PFVISRSTFAGHGHYAGHWTGDVSSNWEQLYYSIPEVLLFNLFGVPLVGADICGFVGNTS
EELCVRWTQLGAFYPFMRNHNDHGTRPQEPYTFSPAAQAAMRNALRLRYSLLPFLYTRFH
RAHSAGETVARPLFLEFPKDPNTWAVDRQLMWGGGLLITPVLEPGKTKVSGYFPAGTWYS
LAGDSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPAFSTTESRKKGMALVVALTLDG
FARGDLFWDDGESWQTFERGDYTEILFLATHGTVLSQLLQASAHLDGVLLEAVTVLGVTS
PPRQVLANGVLVSDFSYRSDTQVLKVPVSLPMWEQFVITWF
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
acagacacccgcctgcacctgcagctgcgggacccggccaggccacgctatgaggtgccc
ctggccgcgccgcgggtgggcggccgcgctgccaccacgctctacggggtgcaggtcaac
caggatcccttcggccttgtcgtctaccggcagcatggcgggcaggtcctggtcaacacc
accgtcgcaccactcttcttcgcagaccagtttctgcagatctccacctccttgccctcc
catttcatttctgggctgggggagcacctgacgccgctggtccttgacacggcgtggacc
agggtcaccctctggaatcgggacatggcgcccacggcccaggtcaacctctatggctcc
caccctttctacctggggatggaggacggtggtttggcccacggtgtctttctgctgaac
agcaatgcaatggatgtgctgctgcagcccagcccggccctgacctggcgcacgacaggc
gggatcctggacttctatgtcttcctgggccccgaccccaagagcgtggtgcggcagtac
ttggatgttgttgggtttcccttcatgcccccatattggggcttgggcttccacctctgc
cgctggggctactcctccaccgacatcacccggcaggtcgtggacaacatgacggcagcc
cgctttcccctggacgtgcagtggaatgacatggattacatggatgccaagagggatttc
accttcaacaagaaaagctttaaggactacccggagatggtgcgggacttccaccgtcgt
gggctgaggtacatcatgatcgtggatcctgggatcagcagctcggggcctcctggcacc
tacaagccctacgacgagggactgaagcgaggggtgttcatccaaaatgccacggggcag
cccctgattgggaaggtctggccgggcccgacggccttcccagattttaccaacccagag
actcacgagtggtggcacgatatggtgaaggacttccacaaccaagtgcccttcgatggc
atgtggattgacatgaacgagccgtcaaacttcgtggaaggctcccaggatggctgcccc
aacaacagcctggagcagccaccctacgtgccaggcgtgttcgggggacgcctgcaagcc
ggcaccatctgcgcatccagccagcagtacctgtcctcccactacaacctgcacagcctc
tacgggctgactgaggccatcgcctcccacgatgcgctgctgagggtcaggggcaagcgc
ccctttgtcatctcacgctcgacatttgctgggcatgggcactacgcagggcactggaca
ggggacgtcagcagcaactgggagcagctctactactccataccagaggtgctgctcttc
aacctctttggggtgccactggtgggtgctgacatctgcggctttgtgggcaacacatcc
gaggagctgtgcgtgcgctggacccagctgggcgccttctaccccttcatgaggaatcac
aatgaccatggtacccggccacaggagccgtacaccttcagcccggctgcccaggctgcc
atgaggaacgctctccgtctccgctactccctcctgcccttcctctacacccgcttccac
cgggctcactctgctggggagacggtggcgcggcccctcttcctcgagttccccaaggac
cccaacacctgggccgtggaccgccagctcatgtggggggggggcctgctcatcacaccc
gtgctggagccaggaaagaccaaagtcagcggctacttcccagcggggacgtggtacagc
ctcgcaggggactccaccatccacagcaaggggcagtggatcctcctgccagctcccctg
gacaccattaatgtccatgtccgtgcaggacacatcctgcccttgcaggaacctgcattc
agcaccactgagtcccgcaagaaagggatggccttggtcgtggcactgaccctggatggc
tttgccaggggagacctgttctgggacgatggggagagctggcagacctttgagaggggg
gactacactgagatcctcttcctggccacacacggcactgtgctcagccagctcctgcag
gcgagtgcccacctcgatggggtcctgctggaggctgtgaccgtgctgggcgtcaccagc
cctccccggcaagtcctggccaatggtgtcctcgtgagcgacttctcctaccgcagcgac
actcaggtgctgaaagtgcctgtgtcgctgccgatgtgggagcagtttgtgatcacttgg
ttctga

DBGET integrated database retrieval system