KEGG   Falco cherrug (Saker falcon): 102051535Help
Entry
102051535         CDS       T02911                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10 isoform X1
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fch03036]
    102051535 (HDAC10)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102051535 (HDAC10)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102051535 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102051535
NCBI-ProteinID: XP_014135011
LinkDB All DBs
Position
Unknown
AA seq 684 aa AA seqDB search
MTAMASGTALIYDEEMTTHKLLWSDPICDIEVPERLSSSYEQLKCYHLVERCVQVPAREG
SEEEILLVHSSEHLEVAKSTQTMNEEELKRVSGNYDAFFFHPNTYCCARLAVGATLQLVD
AVMLGKVCNGMALVRPPGHHSQKNAANGFCLFNNVAIAAEYAKLKYSLQRILIVDWDVHH
GQGTQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGRGKGFNVNLPWNKVGMEN
SDYLAAFFHVLLPMAFEFDPELVIVSSGYDSGIGDPEGQMNATPEVFAHLTHFLMQLANG
RLCVILEGGYHLKSLSESVCMTVKTLLGDPVPQITGEMAPCLSAVESIQNVRAAHKPYWK
WLMYEDTSFLQNLSTKSHVLKKPDLDPSTEYESKIINVNEIVKVERFLELHMKNILFPVP
PIKTAATDSKGSAHLLPVPVHLVKEMDKSEIKALLSGFYADLVEEDKSLLSLGNMLVILD
KILKKEVCNGIAASPTAAVSVAVALRHAVRFGFQRVLCIFVGDMQIIPNTEDGKILMIHI
CEEEQSEKTSSKHYISLNWKEDAEGNDFFAAVLGFILPIAYSYQPDLTVIAVGPNRSLGI
SGISLLFALLQGLAESRIFAVIEDTEIILMQSVAKVLVGASTPHFGVYVPPTQEKVNKIK
LLRDQFQEEWKMLQCSVKDGISRN
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaatggcttcaggaacagcgctgatttatgatgaggaaatgaccactcacaaa
ctgctttggagcgatcctatttgtgatattgaagtgccagaaagactgtcatcctcctat
gagcagcttaaatgttaccatcttgtggaaagatgtgtccaggtgcctgccagagaagga
agcgaagaggagatcctgttggttcacagttcagaacacttggaagtggcgaaaagcacc
cagacaatgaatgaagaggaactgaaaagagtctctggaaattatgatgcttttttcttt
catccgaacacttactgctgtgccagactagcagtaggagcaactttgcagctggtggat
gctgtgatgttgggaaaagtgtgcaacggaatggcattagtaagacctccaggtcaccac
agccagaagaatgcagctaatgggttctgtttgttcaacaatgttgctattgcagcagaa
tatgcaaaactgaaatacagtctgcagagaatcctgattgttgactgggatgtgcaccat
gggcaaggaactcaatatatatttgaagaggatccaagtgttctgtatttttcctggcat
cgctatgaacatcaggaattctggccttcactcaaagaatctgattatgatgctgtggga
ctgggaagaggaaaaggttttaatgtaaatttgccttggaataaggtcgggatggaaaat
tcagattatcttgctgcatttttccatgtgttgcttccaatggcttttgagtttgatcct
gaactggttattgtctcttctggatatgattctggaattggagaccctgaaggtcagatg
aatgccactcctgaggtttttgcccaccttactcatttcctgatgcagttggctaatgga
aggctgtgtgtcatcctagagggtgggtaccacttaaaatcattgtctgaatcggtctgc
atgactgtaaaaactttgcttggagatcctgtacctcaaataactggagaaatggcacct
tgcctgagtgctgttgaatctattcaaaatgtgagagcagcacataaaccctactggaaa
tggttgatgtatgaagacacatcatttttacaaaatttgagcaccaaatcacatgtacta
aagaagcctgatctggatccctccaccgaatatgaatctaagataattaatgtcaatgaa
attgtcaaagtagaaaggtttttggaacttcacatgaaaaatattctgtttccagtgcct
cccatcaaaacagcagcaactgactctaaaggttcagcacacttactccctgtacctgtt
catttggtgaaggaaatggacaaatctgaaataaaagctcttctcagtggcttttatgca
gaccttgtggaagaggacaaaagtttgctgtctcttggcaatatgttggtcatcctagat
aaaatacttaaaaaggaggtatgcaatggaattgcagcatcacccacagctgctgtttct
gttgctgttgcactaagacatgctgttcgttttggatttcaaagagtgctttgtatattt
gtgggagacatgcaaatcataccgaacacagaagatggaaaaatactcatgatacatatt
tgtgaggaagaacagtctgaaaagaccagctccaaacactatatttctctaaactggaaa
gaggatgctgaaggaaacgacttctttgctgctgtacttggattcattcttcctatagca
tatagttatcagcctgacttgacagtaatcgctgttggaccaaataggagccttggaatc
agtgggatttctctgctttttgctttactacaaggattagctgaatctcgaatttttgct
gtgattgaggacacagagataattttaatgcaaagtgtagccaaagtgttagtgggtgct
tctacacctcactttggagtttatgtacctcctacccaagaaaaagtaaataaaataaaa
ttattgagagaccagtttcaggaggaatggaaaatgcttcagtgttcagtgaaggatggg
atttcaagaaattga

DBGET integrated database retrieval system