KEGG   Falco cherrug (Saker falcon): 102051571Help
Entry
102051571         CDS       T02911                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00500  Starch and sucrose metabolism
fch01100  Metabolic pathways
fch04910  Insulin signaling pathway
Module
fch_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102051571 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102051571 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fch01003]
    102051571 (GYS2)
Enzymes [BR:fch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102051571 (GYS2)
Glycosyltransferases [BR:fch01003]
 Polysaccharide
  Storage polysaccharide
   102051571 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_trans_1_4 Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 102051571
NCBI-ProteinID: XP_005433732
LinkDB All DBs
Position
Un
AA seq 702 aa AA seqDB search
MPLARSLSMNSLNGLPQWEDEDLPVEHLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLVGPYFEHNVKTQVEACEPPHLAVKKAMDTMKSQGYQVYFGRWLIEGSPYVLLFDI
GAAAWNLDRWKGEFWDVSNIGIPFHDQEANDAVIFGSLTAWFLKELSCQFADKPNVIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITAVEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFSLEKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLNKI
LDRDDMTIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRYPRPSSVPPSPSVSQHSSPHHSED
EDEDERYDEDEEAERDRQNIKSPFSLGVLPQGKKKQHGEYRN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactgtccatgaattctcttaatgggcttcctcagtgggaggat
gaagacctaccagtggagcacttgttgctctttgaagtttcttgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagctaaaactacagcagatgaatggggt
gaaaactattttctggttggtccctattttgagcacaatgtgaagactcaggtggaagca
tgtgagcctccacacctggcagttaagaaggcaatggacaccatgaaaagccaagggtat
caggtctattttggaagatggctgatagagggcagcccatatgtcttactgttcgatata
ggagcagcagcttggaatctggacaggtggaaaggtgaattttgggatgtcagcaacata
gggatcccttttcatgaccaagaagccaatgatgctgtgatatttggatcgttaacagcc
tggtttttaaaagagctttcctgtcagtttgctgacaaacccaatgtaattgcccacttc
catgagtggcaggcaggagtgggtttaatactgtctcgatctcagaaacttcctgttgcc
acaatttttactacccatgcaactctgcttgggagatacctgtgtgcagccagtatagat
ttttacaacaatcttgaccagtttgacattgacaaggaagcaggagagagacagatttac
catcggtactgtatggaacgggcctccgtacattgtgcccatgtgttcaccacagtctca
cagataacagctgtggaagcagaacatatgcttaaaagaaatcctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcagt
cttgagaagaccttatttttcttcattgctgggagatacgaattttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcataagactgat
gttacagttgtcgtgttcttcatcatgccagcaaagacaaacaatttcaatgtggaaacc
ctgaaaggacaagcggtgcggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaagaaactctacaatgccctgctaaaaggagaaattccagacctgaacaagatt
cttgaccgagatgatatgaccattatgaaaagagccatcttttcaactcagcgacactgt
ctgcccccagtgaccacccacaacatgattgacgatggcaatgatccaatcctcaacacc
atccgacgcattggccttttcaataaccggacagacagagtaaaggtgatcctacatcca
gagtttctttcttcaacaagcccgttgctgcccttggactatgaggattttgttagaggc
tgccaccttggtgtatttccatcgtactacgaaccctggggttacactccagctgaatgt
actgtgatgggcattcccagtgtaaccacaaacctttctggattcggctgtttcatgcag
gaacatgttgctgacccagcggcttatggcatctacatagttgacagaaggttccgctca
cctgatgaatcatgcaaccagctgactcagttcctgtatgggttttgtcagcagtcccgt
cgccagaggatcatccaaagaaaccgaactgagaggctctcagatctgttggactggaga
tacttaggcaggtattacatgcatgccagacacttggccctcagcagaacattcccagat
aaatttgagatggaaccaagtgctccaccaaagacggaaggtttcaggtaccccaggcct
tcatcggtgccaccatcaccttctgtctctcaacattccagccctcaccacagcgaagat
gaagatgaggatgaaagatatgatgaggatgaggaagctgaaagggataggcaaaacata
aagtctcccttttctcttggagtattgccacaaggaaaaaagaagcagcatggagaatac
aggaactga

DBGET integrated database retrieval system