KEGG   Falco cherrug (Saker falcon): 102051672
Entry
102051672         CDS       T02911                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04012  ErbB signaling pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102051672 (CDKN1B)
   04068 FoxO signaling pathway
    102051672 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102051672 (CDKN1B)
SSDB
Motif
Pfam: CDI US6
Other DBs
NCBI-GeneID: 102051672
NCBI-ProteinID: XP_005446073
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRQEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDFYFRPPRLLKTVCKSAGRQSLDVNGNCQTVVFVG
SQGISEDTHCVDQKTDVSENQTDFAEQCIGQRKRPATDDSCPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgaatttctaatgggagccctaccctggagcgcatggaagccaggcag
tcggagtacccgaagccgtcagcttgcaggaacctcttcgggccggtgaatcatgaagag
ttaaacagggacttgaagaagcaccgccaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaagccactggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagaccccccaggctactgaaaactgtctgcaag
tctgccggccgccagagcttggatgtaaacgggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagatcaaaagactgatgtttctgaaaat
cagacggactttgcagagcagtgcattgggcagaggaaaagacctgccaccgatgattcc
tgtcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcaagcccgagaagacatcaaacgtaa

DBGET integrated database retrieval system