KEGG   Falco cherrug (Saker falcon): 102051755Help
Entry
102051755         CDS       T02911                                 

Definition
(RefSeq) transmembrane protease serine 5-like
  KO
K09636  transmembrane protease serine 5 [EC:3.4.21.-]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fch01002]
    102051755
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102051755
Peptidases [BR:fch01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102051755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Trypsin_2 DUF1986 SRCR Hepsin-SRCR Methyltranf_PUA
Motif
Other DBs
NCBI-GeneID: 102051755
NCBI-ProteinID: XP_005437733
LinkDB All DBs
Position
Un
AA seq 378 aa AA seqDB search
MALVSFRINVANSLLEAQMEGHPGWLLVCHEHWSLSLGTLLCRQLGYLRMTHQKGVNLTD
VKVNNTQEFVQVRPHQEGSLEDMWQVRSSCQSGRIAALKCSECGLRRGAARVVGGADVPP
GRWPWQVSVYHGSQHHCGGSVLAHEWIVTAAHCVHSYRRLQASAWLVFAGVITHGSIKQE
AGVSVKKIIYHPLYNDNSLDYDIALLKLQVPLNFSDAVRAVCLPPAQQDLFQGTQCWVFG
WGYTRPDQAQVTETLKEALVPLIGTKRCNSSCMYAGELTARMLCAGYLHGKIDACQGDSG
GPLVCQDEAAWRLVGIVSWGQGCAEPNHPGVYTNVAQLLPWIHHVTEVKAEAKGFLTPCH
GCARLTQQAERLFHSAVT
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggctttagtgtctttcaggataaatgtggccaactccttgctggaagcacagatggaa
ggccaccccggctggctcctggtgtgccatgagcactggagtctctccctgggcaccctg
ctctgccggcagctcgggtatctcaggatgacccatcagaaaggagtgaacctgacagat
gtcaaggtgaacaacactcaggagtttgttcaggtgagaccccaccaggaaggcagcctg
gaagacatgtggcaggtcaggagcagctgtcaatcaggtcgaattgcggctctgaaatgc
tcagagtgtgggctgcgccgcggggctgcgcgggtggtggggggcgcagacgtgccccca
gggcgctggccctggcaggtcagcgtgtaccatggctcccagcaccactgcggaggctcc
gtgctggcacacgagtggattgtcacagcagctcactgcgtgcacagttacaggcggctt
caggcctctgcctggctggttttcgcaggcgttatcacccacggctccatcaagcaggag
gctggggtatcggtaaagaaaataatttatcacccgctttataacgacaacagccttgac
tatgacattgctctgctgaagctccaggtccccctgaatttctcagatgccgtccgtgcc
gtgtgtctgccgcccgcccagcaggacctcttccagggcacgcagtgctgggtgttcggc
tggggctataccagaccagaccaagcacaggttaccgagacactgaaggaagcactcgtt
cccttgatcggtaccaagcggtgcaacagctcgtgcatgtacgccggcgagctcactgcc
aggatgctgtgtgccggctacctgcacgggaaaatcgacgcgtgccagggtgacagcggg
gggcccctggtctgccaggatgaagccgcctggcgcttagtaggcatcgtgagctggggg
cagggctgcgcggagcccaaccaccctggggtttataccaatgtggcccagctcctgcct
tggattcatcacgtcactgaggtaaaggcagaagccaaagggttcctcaccccctgccac
ggctgcgctcggctgacccagcaggcagaacggctgttccattccgcagtgacttag

DBGET integrated database retrieval system