KEGG   Falco cherrug (Saker falcon): 102051829
Entry
102051829         CDS       T02911                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2 isoform X2
  KO
K05691  catenin alpha
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102051829 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102051829 (CTNNA2)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102051829 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 102051829
NCBI-ProteinID: XP_005442701
LinkDB
Position
Unknown
AA seq 905 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGDQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDENKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYETGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVAST
KYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEYQTRVRRGSQKKHISPVQALSEFK
AMDSF
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgacttctgcaacgtcacctatcattttgaaatgggaccccaaaagtttggaaatcagg
actctcacagtagagaggctattggagccgctcgttacccaggtaacaacgcttgttaac
acgagcaataaaggaccatctggcaaaaagaaagggcgctctaagaaggctcatgtgttg
gctgcttcagtggagcaggctactcaaaactttttggaaaaaggagatcaaattgctaaa
gaaagccaggatctcaaggaggaattggttgctgctgtagaggatgtacgcaaacaagga
gaaacaatgagaattgcctcttcggagtttgctgatgacccatgctcctcagtaaaacga
ggcaccatggtgcgggctgctcgtgccttgctttctgctgtcactcgcttactcatcctg
gctgatatggctgatgtcatgaggcttctatcacatctgaaaattgtagaggaagctcta
gaagcagtgaaaaatgcaacaaatgagcaagatttagcaaatcgctttaaagaatttgga
aaagagatggtaaaactgaactatgtagctgctagacgacaacaggaactgaaagatcct
cactgcagggatgaaatggctgcagctcgaggtgctctgaagaagaacgccactatgttg
tatactgcatcccaagcatttctccgtcaccctgacgttgcagctactagagccaacaga
gattatgtcttcaagcaagtacaggaagcaattgctggtatctccaatgctgcccaggcc
acctcgcccactgatgagaacaaggggcacactggtataggagaacttgctgctgcatta
aatgaatttgataacaaaattattttagacccaatgactttcagcgaggcccgcttcagg
ccgtctcttgaggaaaggctggagagcatcatcagtggagctgcgctgatggcagactca
tcgtgcacacgtgatgaccgccgggagcgaatcgtagcagagtgcaacgccgtgcggcag
gccctgcaggatctgctcagcgagtatatgaataatactggaaggaaagagaagggagac
ccactcaacattgctattgacaagatgaccaagaaaacacgagaccttcgaagacagctg
cggaaggcggtaatggatcatatatcggattcattcttggagaccaatgtcccattactg
gttctcattgaggctgcaaaaagcggtaatgagaaagaagtgaaggagtatgctcaggtc
ttccgtgaacacgccaacaagttagttgaggtagcaaatctggcctgttcaatatcaaat
aatgaagaaggtgtgaagttagtccgtatggcagcaacacagattgatagtctgtgccca
caggtaataaatgctgcgctcacactagctgccagaccgcagagcaaagtagcacaagac
aacatggatgtctttaaagatcagtgggagaaacaagtgcgagttctcactgaagctgtt
gatgacatcacttcggtggatgatttcctctctgtttcagaaaaccatattctggaagat
gtgaataagtgtgtgattgctctccaagagggggatgttgatacactggacagaactgcg
ggtgccatccgaggccgtgcagccagggttattcacatcattaacgcagagatggaaaac
tatgaaaccggagtttatacagagaaggtactggaagctaccaaactgctctctgaaaca
gttatgccacgttttgctgaacaagttgaggttgccattgaagctttgagtgcaaatgtc
ccacagccatttgaagaaaatgagttcatagatgcctcccgcttggtttatgatggagtt
cgtgacatcaggaaagctgttctgatgataaggacccctgaagagctagaggatgattca
gactttgagcaggaagattatgacgttcgcagccgaacaagtgttcagactgaagacgac
cagcttattgctggccagagtgcaagggctatcatggctcagcttccccaggaggaaaag
gctaagattgctgagcaggtagagatattccaccaagaaaagagcaaactggatgcagag
gtggctaagtgggatgacagtggtaatgacatcattgtgttggcaaagcagatgtgcatg
attatgatggaaatgacagactttactagaggtaaaggtcccctgaagaacacatcagat
gtcattaatgcggccaagaagattgcagaagcaggatcgaggatggacaaattggcacgg
gcagtagctgatcagtgcccagactcagcctgcaaacaggatctgctagcttacctgcag
cgcattgccctctactgccaccaactcaatatctgcagcaaagtgaaggcagaagttcag
aacctgggaggagaacttattgtatcagggctggacagtgccacttctctcatccaggca
gctaaaaatctgatgaacgctgtggttcttacagtaaaagcatcatatgtggcttctact
aaatatcagaaggtctatggtactgctgcagtgaactcaccagttgtatcttggaagatg
aaggcccctgagaagaaacctctagtaaagagagaaaaaccagaagagtatcagacaaga
gtgagaagagggtcccagaagaaacatatttcccctgtacaggccttaagtgaatttaaa
gctatggattcattctaa

KEGG   Falco cherrug (Saker falcon): 102056079
Entry
102056079         CDS       T02911                                 

Definition
(RefSeq) catenin alpha-1
  KO
K05691  catenin alpha
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102056079
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102056079
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102056079
SSDB
Motif
Pfam: Vinculin I_LWEQ
Other DBs
NCBI-GeneID: 102056079
NCBI-ProteinID: XP_005433924
LinkDB
Position
Unknown
AA seq 455 aa
MSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDF
LAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEK
VLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLM
IRTPEELDDSDFETEDFDVRSRTSIQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASF
QEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAE
AGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSG
VDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVK
REKQDETQTKIKRASQKKHVNPVQALSEFKAMESI
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtcagccagccaacttgaagctctgtgtccccaggtcattaatgctgcactggctctg
gctgctaaaccccaaagcaagctggctcaggaaaacatggatctcttcaaagagcaatgg
gagaagcaagtccgtgtgctgacggatgctgttgatgacatcacttccattgatgacttc
ctggctgtatcagagaatcatattttagaagatgtaaacaaatgtgtcattgctctccaa
gaaaaagatgttgatggtttagaccgcacagctggtgcaattcgagggcgtgctgctaga
gtcattcatgttgtcacttctgaaatggataactacgaacctggggtctacactgagaag
gtgttggaagcaacgaagttactgtccaacacagttatgccacgctttactgagcaagta
gaagctgctgtggaagcactgagttcagaccctgcccagccaatggatgaaaatgaattt
atcgatgcttcgcggctggtgtatgatggaatacgagatatcaggaaggccgtactgatg
atccggactcctgaagagttggatgattctgactttgagaccgaggattttgatgtccga
agcagaacaagtattcagactgaagatgatcagctcatcgctggacaaagtgcaagggct
atcatggctcagctccctcaagagcaaaaagctaagattgctgagcaagttgcaagcttc
caggaagaaaagagtaaattggatgctgaagtatcaaaatgggatgacagcggtaatgat
ataattgttctggcaaaacaaatgtgtatgattatgatggaaatgacagacttcaccaga
ggtaaaggtccactgaaaaatacgtcagatgtgattagtgcagccaagaagattgcagag
gctgggtcaaggatggacaagctgggacggactattgctgaccactgtcccgattctgcg
tgcaagcaggacctcctggcctacctgcagcgcatcgcactgtattgccaccagctgaat
atctgcagcaaagtgaaggctgaagttcaaaacctcggaggggagctggttgtgtctggg
gtggacagtgccatgtctcttatccaagcagccaagaacctgatgaatgcggtggtgcaa
accgtgaaggcttcctacgtggcatcaaccaagtaccagaagtcccaggggatggcttcg
ctcaatctgcccgccgtctcttggaagatgaaggctccagagaagaaacccctggtcaag
agggagaagcaagatgaaacccaaactaaaatcaagcgggcgtcccagaagaaacacgtt
aacccggtgcaggctctcagtgaattcaaggcaatggagagtatttaa

KEGG   Falco cherrug (Saker falcon): 102057954
Entry
102057954         CDS       T02911                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3 isoform X1
  KO
K05691  catenin alpha
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102057954 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102057954 (CTNNA3)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102057954 (CTNNA3)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 102057954
NCBI-ProteinID: XP_005433514
LinkDB
Position
Unknown
AA seq 896 aa
MSTKVPSIKLKIDPQDLQIQTFTVEKLLEPLIIQVTTLVNCPQNPSSKKKGRSKRARVLL
ASVEEATWNLLDKGEKIAKEAIVFKEELHAALADVHKESQALKVSAEAFTSDPCYLPKRQ
AVVQAARSLLTAVTRLLILADMVDVAYLLEHLTVFQRTFESLRNVSSKSDLQKTYQKFRK
DLENLDDLAYKRQQDLKSSNQRDEIAAARASLKENSSLLHSVCSACLEHSDVASLAASKD
SICNEIQNALNVISNASQGVGNKVGQPASHTATLGSALDELENLIILDPLVVNEEKIRPS
LEKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYINNTDKKERSNAL
NVAIDSMCKKTRDLRRQLRKAIIDHISDSFLDTTVPLLVLIEAAKNGRDKEIKEYAAIFR
EHTSRLVEVANLACSLSTNEDGMKIVQMAANHIETLCPQVINAALALAARPKSQVVKNNM
EMYRSTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALREQNVDNLDRAAGA
IRARASRVAHIVSGEMDNYEPGAYTEGVMTNVQYLTKNVIPEFISQVNIALESLSKSTVH
SFDDNQFVDISKKVYDTIHNIRCSVMMIRTPEELEDVSDLEEDHDARSRTSIQTEGKTDR
AKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKRMCVIMMEMTDFT
RGRGPLKNTSDVINAAKMISESGSRMDVLARLIANQCPDQSCKQDLLAYLEQIKLYSHQL
KICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIKIQSPT
GPRHPVVMWRMKAPEKKPLIKREKPEEIYAAVRKGSAKKRIHPVQVMSEFRGREIV
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgtcaacaaaagtgccgagcattaaactgaaaattgatcctcaggatctgcagatccag
acttttacagtggagaaattactggaaccattgataatccaggttacaacactagtgaac
tgtccacagaatccttctagtaagaaaaagggccgttctaaaagagctcgtgtcttgcta
gcatctgtggaagaagccacttggaatctgttggacaagggggaaaaaattgccaaggaa
gcaattgtgtttaaagaggaacttcatgcagcacttgctgatgtccacaaagagagtcaa
gccttaaaggtatcagcagaggcatttaccagtgatccctgctatctgcctaagaggcag
gctgttgtccaagcagcacgatctctgcttacagctgtcacaaggcttctaattctggca
gacatggttgatgtggcatacttactggaacatttaactgtgtttcaaagaacgtttgaa
tctttaagaaatgtatccagtaagtctgatctacagaaaacctaccagaagtttcgaaaa
gatctggaaaatcttgatgatttagcatacaaacgtcagcaggatttgaaatctagcaat
cagcgagatgaaattgctgcagcacgtgcatccctgaaggaaaattcctctctcctacat
tcagtatgttcagcttgtttggaacattcagatgttgcatcccttgcagccagcaaggat
tcaatttgcaatgaaatacagaatgctctcaatgtaatttctaatgcttcccaaggagtt
ggaaataaagtgggacaacctgcatctcacacagctactcttggaagtgcacttgatgag
cttgagaatttaattatcctggatcctcttgtagtgaatgaagagaaaataaggccatca
ctagagaaacgtctggaagctattatcagtggagcggctttgctagctgattcttcctgc
acgcgtgattttcatcgagaacgcatcattgctgagtgcaatgctattcgccaagctctc
caagatctgctttctgaatacatcaacaatactgacaagaaagagagaagtaatgccttg
aatgttgcaatagatagtatgtgcaagaagacaagagacctccgcagacagctccgtaaa
gccattatagatcacatctcagactccttcttagataccactgttccactcctagttctc
attgaagctgctaaaaatggaagagataaagaaataaaggaatatgctgctatatttcga
gaacataccagcaggcttgtggaggtggctaatcttgcttgttcattgtcaacaaatgaa
gatggaatgaaaattgtccaaatggcagctaatcacatagagactttgtgcccacaggtt
attaatgctgctttagctcttgctgccagaccaaaaagtcaagttgtgaaaaacaacatg
gagatgtatagaagtacatgggagaatcacatccatgttcttactgaagctgtggatgat
ataacaagtattgatgattttcttgctgtatcagaaagccatattcttgaggatgtaaac
aagtgtatcattgcactgagagagcaaaatgtggacaatttagatcgtgcagcaggtgca
atccgagcgcgtgcttcaagagtagctcatattgtttcgggtgagatggacaactatgaa
ccaggggcttacactgaaggagtgatgacaaacgttcagtatttgaccaagaatgtgatt
ccagagtttattagtcaagtaaatattgcattggagagtttaagcaagagcacagtgcat
tcatttgatgataaccagtttgtggacatctctaagaaggtgtatgatacaattcataac
atcagatgctcagtcatgatgattcggacacctgaggagctagaagatgtatctgacctt
gaagaagaccatgatgcacgtagtcgtacaagtattcagaccgaagggaaaactgacagg
gccaagatgactcagttgccagaggctgaaaaggaaaagatagctgagcaagtggctgac
ttcaaaaaagtcaagagtaagcttgatgcagagattgaaatttgggacgataccagcaat
gacatcattgttttggccaagaggatgtgtgtgattatgatggagatgactgacttcaca
aggggtagaggaccgctgaagaacacatctgatgtaattaatgcagccaaaatgatttcg
gagtcaggatcaaggatggatgtcctagcacggttgattgccaatcagtgtccagaccaa
tcgtgcaaacaggatttgttggcttacctagaacagatcaagctgtactcccatcagctc
aagatctgcagtcaagttaaagcagaaatccagaatctaggtggagagctcatcatgtct
gctttggatagcgtcacatcactaattcaggctgcgaaaaatttaatgaacgctgtggtg
cagacagtgaagatgtcctatattgcatccacaaagattatcaaaattcagagtcctact
ggcccacgacatcctgttgtgatgtggagaatgaaggctccagagaagaagcccctaatt
aaaagagagaagccagaagaaatctatgcggctgtcagaaaaggttctgcaaagaagaga
attcatcctgttcaagtaatgagtgaatttagaggcagagaaatagtctaa

DBGET integrated database retrieval system