KEGG   Falco cherrug (Saker falcon): 102052074
Entry
102052074         CDS       T02911                                 

Gene name
PTPRB
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase beta
  KO
K05694  receptor-type tyrosine-protein phosphatase beta [EC:3.1.3.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102052074 (PTPRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102052074 (PTPRB)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102052074 (PTPRB)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    102052074 (PTPRB)
SSDB
Motif
Pfam: fn3 Y_phosphatase PTP_tm SdrD_B Ricin_B_lectin Pur_ac_phosph_N Glyco_hydro_66 Y_phosphatase3 DSPc PTPlike_phytase Big_4
Other DBs
NCBI-GeneID: 102052074
NCBI-ProteinID: XP_027668851
LinkDB
Position
Unknown
AA seq 2119 aa
MDSLFHVLVSTCLALTFSEGFLIIHVQKQQCLSEKRGVIMEKCNMTNLNQRWQWMADDRL
LHVKSARCLSISTRSALSSRSITVDCSQAVRWTCQEEDGLLKVANSSLFLTKQGQKVMAK
QSKKYLHTWMQLEASETGKPVYVNLCSKQGLPDADISVWSTRTTSPPLNTVTPKPENLLK
SSTEMFIRNVTEHVSKNLTENLYFDLKSAVTEKAWIPTTTLQYSSTTEEINPLPPPRVEI
NKEKATLTSLQVQWDPSPGKVDLYNLVLFDHENKKIQEVSVPGSISKTEYTFSSLIPGNK
YNVVLSAAAGNKTTPELHTSGSTVPSPVKNIQVTVKTDTIHASWSPGSGHVDSYRLVLTD
NHVPVHEIHQEDPLTSYSFSGLTAGHLYNLSIITQAAGLESSSSQTVRTAPAEVLDLTVT
NDDSLDALKVQWRRPSGNLNFYNITLSHLGSVKEVKTLQPPVTETHFDKLTPGRLYQVTA
RTISGELFTDRMATGRTFPHKVSELRAGGGGWLRSLRVNWLPPAGDWERYHLLLWNRSAL
VLNTTLEKDTTEYLIHDVGLIPGRQYSVDVIVESGDLQSKTSCTGRTAPEPVLHLRVKHA
NESSLSVMWMTPVAEWDSYVVSLGDRDLTVIKKGLAKEAKEFTFTDLVPGRKYTATITTI
SGILSNWTSVEGRTVPAQVTGLTVASQGSTNSLFTNWTRALGDVDSYQVLLIHENVVIKN
ETVPSETNRYHFYPLKPGGLYSVVVTTVSGGISSRQTIAEGRTVPSSVTGVTVNNSGRSD
YLSVSWLPASGDVDSYLVTLSHDDQIVQTLTISKSFSECSFSSLTPGTLYNVMITTKSGK
YENYSFSQERTVPSSVQGLTVSNSARSDYLKVSWLHASGYFDNYEVIIKNNNDFIQTKSV
PKDENECVFTNLVPGRQYSVTVSTKSGKYETSERIYGRTMPESVKELTLSNRSTEDLQVT
WLKAEGDVDKYEIQLLFNDMKIFPPIFLGNTVEEYWFTALTPGRLYKILVLTISGDAQRA
TFIEGLTIPSVVRNIHVSPNGMTNSLKVSWTPGGGDVDSYTVTIFQQNHQLDSQSVSKHV
SEHTFHKLEAGEQYQVVVQSNSGTLHNSLAAFGRTIPASVQELLARHAYSSHSLLVTWQK
APGVAERYDILLLNEQGILLSNKSEPATAKQHKFEDLLAGKKYKIQVFTVSGGLFSKRAE
TVGRTVPAAVTNLKVTENTPDRLSFSWTTSQGELDSYDIFLYNPDKSLHDRISGEQHLQQ
CSFQNLRQGRMYRMVIVTHSGDLTNESSVFGRTVPAPVVGLKASNRNMTDSLWFTWSPAA
GDVDFYELNLYNPNGSQKETWHRKDLKEWHFQGLVPGRKYTLLVVTHSGDLTNTANAEGR
TAPSPPNTVSFTDVTNTSLSITWLGPPDWTDYDDFELQWLPKDHLTVFNPYSSSKSKVRI
IYGLRPGRLYEFNVRTVSGDSWKTYSQSQSASVRTKPDKIQSLHCRPQTSTAIACSWTPP
DSDFDGYSVECKKMDTREVEFSKRIEKDKSLLNIMTLVPHKRYLVSIKVHSADMTSEVVE
DSTITMIDRPPQPPPDIRVNKKEVLITKSSINFTFNCSWFSDTNGAVKYFTVVVREADGS
EGPKPDEQHPLPSYLEYKQNDSIRIYQTNYFASRCAENPDSDYKSFDIKLGGEMENLGGR
CDPDQQKFCDGPLKPRTAYRISIRAFTQLFSEDPKELPKPLFADTFFSLPITTEAEPLFG
VIEGVSAGLFLIVMLVAVTALFVCRQKVSSGHERPTARLSIRRDRPLSVHLNLGQKGNRK
TSSPIKVSHFEAHFTKLQADSNYLLSKEYEDLKDVGRNQTCDIALLPENRGKNRYNNILP
YDTSRVKLSNVDDDPCSDYINASYIPGNNFRREYIATQGPLPGTKDEFWKMAWEQNVHNV
VMVTQCVEKGRVKCDHYWPLDQDSLYYGDLIVEMLSESVLPEWTIREFKICSEEQLDSTR
LIRHFHYTVWPDHGVPETTQSLILFVRTVRDYINRTPDTGPTIVHCSAGVGRTGTFIALD
RILQQLDSKDTVDIYAAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLF
PIYENVNPEYHRDAVYSRH
NT seq 6360 nt   +upstreamnt  +downstreamnt
atggactctttatttcacgtcctggtttctacctgtcttgccttgacattctcagaaggg
tttctgattatccatgtccagaaacagcaatgtctttcagaaaagagaggagtcattatg
gaaaagtgcaatatgaccaacctcaaccagaggtggcagtggatggcagatgacaggctc
ctccatgtgaaatctgcccggtgcctgagcatctccacacgctctgccctgtcgtctcgc
agcatcactgttgactgttcccaggcagtcaggtggacttgccaggaggaggatgggctc
ctgaaggtggccaacagctctctctttctcacaaagcaaggtcagaaggtaatggccaag
cagagtaagaaataccttcacacatggatgcagctagaagccagcgagacgggaaaacct
gtttatgtaaatctgtgctcaaagcaaggtctccctgatgcagacatttctgtatggagt
actagaactacatctccccctttaaacactgttacacctaagcctgaaaatctgctaaag
agtagcacagagatgttcatcagaaatgtgactgaacatgtcagtaaaaatcttactgaa
aacctctacttcgacttgaaatctgcagtaacagagaaagcctggattccaacaactact
cttcaatactctagcaccacagaagagatcaatcctttaccaccacctcgagttgaaatt
aataaggaaaaagctacacttacaagcttgcaggttcagtgggatccttccccaggaaag
gtggacttgtataacctagtattatttgatcatgaaaataaaaagatacaagaagtctct
gtaccaggaagtatttcaaaaacagaatacacattttctagtctcatccctgggaataaa
tacaatgttgtcctcagcgcagctgctggaaataagactaccccagaacttcacacaagt
ggatctactgtgccatcccctgtgaaaaatattcaggtcactgtcaagacagacactatc
catgcttcatggtctcctggctctggccacgtggattcttacaggctggtgttaacggat
aatcatgtcccagttcatgagattcaccaagaagatcctctgacttcctacagtttttca
ggacttacagcaggccacctgtataacctctctatcataacccaggctgcaggactggag
agcagcagttctcaaacagtcaggacagccccagccgaagtcttagatttgacggtgact
aacgatgacagcttagatgctttaaaagttcagtggagaagaccttcaggaaacctcaat
ttctataatatcactctgtctcatcttggatcagttaaagaagtcaaaactctacagcca
ccggttacagagactcactttgacaagctaactccaggacgtctttatcaggttactgcc
cgcacaatcagtggtgaattgtttactgatcggatggcaactggcagaacatttccccac
aaagtttctgagctgagagccggtggtggtggctggctgcggtccctgcgagtgaactgg
ctgccccctgcgggagactgggagaggtaccacctgctcctgtggaaccgctcggccctg
gtgctcaacaccaccctcgagaaggacaccacggagtacctcatccacgacgtgggcctc
atcccggggaggcagtacagcgtggatgtcattgtggagagtggggatttgcagagcaag
actagctgcacagggagaacagctccagagcctgttctccatctccgtgtgaagcatgct
aatgaatcttcacttagtgtcatgtggatgacacctgttgcagaatgggacagctatgtg
gtttcactgggagacagggatcttactgtcataaaaaaaggacttgcaaaagaagctaag
gaattcactttcactgacttggtacctggaagaaaatacacagctaccatcactaccatt
agtgggattttaagtaactggacttcagtggaaggaagaacagtgccagcccaagtgact
ggtctgaccgtggcaagtcagggatcaaccaacagcttgttcaccaactggacaagagca
ctgggagatgtagactcataccaagtgctactgattcacgagaatgttgtcattaaaaat
gagactgttcccagtgaaaccaacagataccacttctatcccctgaaacctggaggactc
tattcagttgttgtcaccactgtcagtggtgggatatcttcaaggcaaacgatcgcagag
gggaggacagttccttccagcgtgactggagtaacagtaaataactcaggtcgcagtgac
tacctcagtgtttcttggctgccagcttctggagatgtagacagttatttggtaacgctc
tctcacgatgaccagattgttcagactctcaccatttccaaatccttcagtgaatgctcc
ttcagcagcctcactcctgggacgctttacaatgtgatgataaccacaaagagtgggaag
tatgaaaattattccttcagccaggaacgaacagtcccttccagtgttcagggacttact
gtcagcaattcagccagaagtgactacttgaaggtgtcctggttacacgcctctggatat
tttgataattatgaagtgatcatcaagaacaacaatgatttcatccaaacaaaaagtgtc
ccaaaggatgaaaatgaatgtgtgttcactaatctggtcccagggaggcagtacagtgtc
acggtcagcacaaagagtgggaaatacgaaactagtgaaaggatctatggaagaacaatg
ccagagtcagtgaaggaactgactcttagtaataggagcacagaagatctgcaggtaact
tggttaaaggctgaaggggatgttgataaatatgagattcagctcctcttcaatgatatg
aagatcttcccacccattttccttgggaacaccgttgaggagtattggttcacagctctg
actccaggacgtctatacaaaattcttgtcttgaccatcagtggagatgcacaacgtgct
actttcatagaaggcctgacaattccaagtgtggtcagaaacattcatgtgtcacctaat
ggcatgacaaacagcctgaaagtgagctggactcctggaggtggagatgttgattcctac
acagtgactatatttcagcaaaaccatcagcttgattcccagagtgtctctaaacatgtc
tctgagcacacgtttcacaagttggaagctggggagcagtaccaggtggtggtgcaatct
aacagtggcaccttgcacaacagcttagcagcttttgggagaacaattccagcctctgtc
caggaattattagcacgtcatgcttacagcagtcattccttgttagtaacctggcagaaa
gctcctggtgtagctgaaagatacgacattctgctcttgaatgagcaaggaatcctcctg
agcaacaaatcagagccagctactgccaaacagcacaaatttgaagatttattggctggc
aagaagtataaaatacaagttttcacagtcagtggtgggctcttcagtaagcgagcagaa
actgttggccgaacagttccagcagctgttacaaatctgaaggtcacagagaacactcct
gaccgactgtccttcagctggaccacctcgcaaggggagcttgattcatatgacatcttc
ctatataacccagacaagtcccttcatgacaggatttcaggagagcagcacctccagcag
tgttcattccagaacttgcggcaaggcaggatgtatcgaatggtgattgttacccacagc
ggagacctcactaatgagtcgtctgtctttgggagaacagtaccagctccagttgttggc
ctcaaggcatccaaccgaaacatgacagacagtctgtggttcacctggagtccagcagca
ggagatgttgacttctatgagctgaatctttacaacccaaatgggtcacagaaagaaaca
tggcacaggaaagacctgaaagaatggcatttccaggggctagttccgggcagaaagtac
acgctgcttgtggtgactcacagtggtgatctgaccaacacagcaaatgctgaaggaaga
acagcacccagccctcctaacactgtatcgtttactgatgttaccaacacttctttatca
atcacttggctgggtcctccagactggacagattatgatgattttgagttgcagtggctt
ccaaaagatcacctcacagtattcaatccctacagcagcagcaaatctaaagtacgcatc
atctatggcctgcgaccaggaagactctatgagttcaatgttagaactgtcagtggtgac
agctggaagacatacagtcagtcacagtctgcaagtgtgagaacgaaaccagacaagata
caaagtcttcattgtcggccccagacctctactgccattgcatgttcctggactcctcct
gattctgactttgatgggtatagcgtcgaatgcaaaaaaatggacactcgcgaagtggaa
ttttctaaaaggatagaaaaagacaaatcactgcttaatatcatgacactcgttccccac
aagcgatacctggtgtccatcaaggtgcattctgcagacatgacgagtgaagtagttgaa
gacagcaccatcacaatgattgaccgtccccctcagccacctccagacatacgagtgaac
aaaaaggaggtcctgattaccaaatcctccatcaactttacttttaactgcagctggttt
agtgatactaatggagctgtgaagtactttactgtggttgttagagaggctgatggtagt
gaaggaccaaagcctgatgagcagcacccattaccttcctacctggagtacaaacagaac
gactctatacgcatctaccagacaaactattttgccagtagatgtgctgaaaaccctgac
agtgactataaaagctttgacattaagcttggaggagaaatggaaaatctgggtggaagg
tgtgatccagatcagcaaaaattctgcgatggacctctaaagcctcggactgcttatagg
atcagcatacgggcttttacccagctcttcagtgaagacccaaaggaactccctaaacca
ctctttgcagacaccttcttctctttaccgatcactacagaagcagagcctctgtttgga
gttattgaaggtgtgagtgctggcttgtttctgattgtgatgttggtggctgttactgct
ttatttgtctgcagacaaaaagtgagcagtggccacgagagacctacagcaaggctgagc
attcgcagggacaggccactgtcagtccatctgaacctggggcagaaagggaaccggaaa
acttccagtccaatcaaagtcagtcattttgaagcacacttcaccaaacttcaagcagac
tccaactacctcctgtccaaggagtatgaggacttgaaagatgtgggtcgaaaccagaca
tgtgacatagcacttctgccagagaacagagggaaaaatcgatacaataatatattgccc
tatgatacatcaagagtgaagctttccaatgtggatgatgacccttgctcagactacatt
aatgcaagctacataccaggcaataatttccgcagggaatacatagcaactcagggccct
ttgcctggcaccaaagatgagttctggaagatggcttgggagcaaaatgttcacaatgtt
gtcatggtaacccagtgtgttgagaagggccgggtgaagtgtgaccactactggcccctt
gaccaggattccttgtactatggagacctgattgttgagatgctgtctgaatcggtgctc
ccagagtggacaatacgagagtttaaaatctgcagtgaagagcagcttgactcaacgagg
cttattcgtcacttccactacactgtctggccagatcatggtgtgccggagaccacccag
tccctgatcctgtttgtcagaactgtaagggattatatcaacaggaccccagacacagga
ccaactattgtgcactgcagtgctggtgttggcaggactggcacattcattgcactggac
agaattctgcagcagctggattcaaaggacactgttgatatttatgcagcagtgcatgat
ctaagacttcaccgggttcacatggttcagacagagtgtcaatatgtgtatctacatcaa
tgtgtgagagatgtgttaagagctagaaaacttcgcagcgagcaggaaaatcccttgttt
ccaatatatgaaaatgtgaatccagaatatcacagagatgctgtttattcaaggcactaa

DBGET integrated database retrieval system