KEGG   Falco cherrug (Saker falcon): 102052096Help
Entry
102052096         CDS       T02911                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00350  Tyrosine metabolism
fch01100  Metabolic pathways
Module
fch_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102052096 (GSTZ1)
Enzymes [BR:fch01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     102052096 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 102052096
NCBI-ProteinID: XP_027660438
LinkDB All DBs
Position
Unknown
AA seq 215 aa AA seqDB search
MASEKPILYSYFRSSCSWRVRIALALKGISYDLVPVNLLKDGGQQFSAEFKAVNPMQQVP
ALKIDGITLSQSLAIIHYLEDICPNPRLLPQDPKKRAQVRMIADHIVSGIQPLQNLSVLK
QIGEKKMEWAQNCIASGFQALEQILQHTAGRYCVEDEVSMADLCLVPQVSNAERYKVDMS
PYPTITRINKALLELEAFKVSHPSRQPDTPAELRA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgaaaagcctatactttatagctatttccgaagttcctgctcttggagagtg
agaatcgcactggctctgaaagggatttcctatgacctggtgcctgtgaacctcttgaag
gatgggggacagcagttttctgctgaattcaaggcagtgaatccaatgcagcaagtccca
gccttgaaaattgatggcatcaccctttctcagtcgctagctataattcattacctagaa
gacatctgtcctaaccccaggctcctgccccaagatccgaagaagagagcccaagtcaga
atgatcgctgatcacattgtctctggcattcagccactccagaacctgagtgtcctgaag
caaatcggggagaaaaaaatggaatgggctcagaactgcatcgcatctggctttcaagca
ctggagcagattctgcagcacactgctgggcgctactgtgtggaggacgaagtttccatg
gctgacctgtgcttggtgcctcaagtttccaatgctgaaagatacaaagtggatatgagt
ccatatcccacaataaccagaataaacaaagctctccttgagttagaggcattcaaagta
agccacccctcccggcagccagatactcctgcagagctacgagcttga

DBGET integrated database retrieval system