KEGG   Falco cherrug (Saker falcon): 102052313Help
Entry
102052313         CDS       T02911                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00480  Glutathione metabolism
fch00980  Metabolism of xenobiotics by cytochrome P450
fch00982  Drug metabolism - cytochrome P450
fch00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102052313 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102052313 (MGST2)
   00982 Drug metabolism - cytochrome P450
    102052313 (MGST2)
   00983 Drug metabolism - other enzymes
    102052313 (MGST2)
Enzymes [BR:fch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102052313 (MGST2)
Transporters [BR:fch02000]
 Other Transporters
  Pores ion channels [TC:1]
   102052313 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 102052313
NCBI-ProteinID: XP_005439239
LinkDB All DBs
Position
Un
AA seq 147 aa AA seqDB search
MAGDSALLAAVSLLSAFQQCHFAWLVGKSRMKHKVMPPAVTGAPEFDRTFRAQQNCVEFY
PIFLTVLWTAGWFFNQELASFLGVLYVFARYKYFHGYVQSVKGRLTGFYLNLIILTCLIT
LGAAGIINSFLDEYLDFSIMKKLSKLF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgattcagctttgcttgcggctgtctctcttctttctgccttccagcaatgt
cattttgcttggctggtggggaaatcaagaatgaagcacaaggtcatgccccccgctgtc
actggggctccagagtttgacagaacatttcgtgcacaacaaaactgtgtggagttttac
ccaatattcctgactgtcctctggactgcaggatggttttttaatcaagaattagcttcc
tttctgggtgtgttgtacgtgtttgcccgctacaagtacttccacggttacgtacagtct
gtgaaaggaaggttaacaggtttctatttgaatttgataattctaacttgcttgataacc
ctgggtgcagctgggattattaacagctttctggatgaatacctagacttcagcattatg
aagaaactgagtaaattgttttga

DBGET integrated database retrieval system