KEGG   Falco cherrug (Saker falcon): 102052372
Entry
102052372         CDS       T02911                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X2
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04012  ErbB signaling pathway
fch04137  Mitophagy - animal
fch04144  Endocytosis
fch04370  VEGF signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04530  Tight junction
fch04540  Gap junction
fch04625  C-type lectin receptor signaling pathway
fch04810  Regulation of actin cytoskeleton
fch04912  GnRH signaling pathway
fch05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102052372 (SRC)
   04370 VEGF signaling pathway
    102052372 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102052372 (SRC)
   04137 Mitophagy - animal
    102052372 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102052372 (SRC)
   04520 Adherens junction
    102052372 (SRC)
   04530 Tight junction
    102052372 (SRC)
   04540 Gap junction
    102052372 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102052372 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102052372 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102052372 (SRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102052372 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102052372 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102052372 (SRC)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102052372 (SRC)
Protein kinases [BR:fch01001]
 Non-receptor tyrosine kinases
  SRC family
   102052372 (SRC)
Membrane trafficking [BR:fch04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102052372 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    102052372 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102052372 (SRC)
  Macropinocytosis
   Kinases
    102052372 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 102052372
NCBI-ProteinID: XP_005439076
LinkDB
Position
Unknown
AA seq 533 aa
MGSSKSKPKDPSQRRRSLEPTDNTHHGGYPASQTPSKAAAPDAHRTPSRSFGTMAAESKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHR
LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPG
TMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRL
PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYR
MPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggggagcagcaagagcaagcccaaagaccccagccagcgccggcgcagcctggagccc
accgacaacacccaccacgggggctacccggcctcgcagacacccagcaaggcagccgct
cctgatgcccatcgcacccccagccgctccttcgggaccatggccgctgagtccaaactc
tttggaggcttcaacacctctgacacggtcacctcgccgcagcgtgccggggcactggct
ggtggagtcaccaccttcgtggccctctacgactacgagtcccggaccgaaacagacttg
tccttcaagaaaggagagcgcctgcaaatcgtcaacaacacggaaggtgactggtggctg
gctcattccctcactacaggacagacgggctacatccccagtaactatgtcgcgccctca
gactccatccaggctgaagagtggtactttgggaagatcactcgccgggaatccgagcgg
ctgctgctcaaccccgaaaacccccgagggaccttcctggtccgggagagcgagaccacg
aaaggtgcctactgcctctccgtctccgacttcgacaacgccaaggggctcaatgtgaag
cactacaagatccgcaagctggacagtggtggcttctacatcacctcccgcacccagttc
aacagcctgcagcagctggtggcctattactccaaacacgctgacggcttgtgccaccgc
ctcaccaatgtgtgccccacgtccaagccccagacccaaggccttgccaaggatgcctgg
gaaatcccccgggaatcgctgcggctggaggtcaagctgggacagggctgcttcggagaa
gtgtggatggggacctggaacggcaccacccgggtggccatcaagaccctgaagcctggc
accatgtccccggaggccttcctgcaggaagcccaggtcatgaagaagctccggcatgag
aagctggttcagctctacgccgtggtttcagaggagcccatttacattgtcaccgagtac
atgagcaaggggagcctcctggacttcttgaagggcgagatgggcaagtacctgcggctg
ccccagctcgtggatatggcagctcagatcgcatctggcatggcctacgtggagaggatg
aactacgtccaccgggacctccgggcggccaacatcctcgtgggggagaacctggtgtgc
aaagtggctgacttcggcttggcgcgcctcatcgaggacaacgagtacaccgctcggcaa
ggcgcgaagttccccatcaagtggacggctcccgaagctgctctgtacggcaggtttacc
atcaagtcggacgtctggtcctttggcatcctcttgaccgagctgaccaccaagggcaga
gtgccgtacccagggatggtgaaccgggaggtgctggaccaggtggagcgagggtaccgc
atgccctgcccgcccgagtgccccgagtccctgcacgacctcatgtgccagtgctggagg
aaggacccagaggagcgacccaccttcgagtacctgcaggctttcctggaggactacttc
acctcgacagagccccagtaccagcctggcgagaacctatag

DBGET integrated database retrieval system