KEGG   Falco cherrug (Saker falcon): 102052736Help
Entry
102052736         CDS       T02911                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04020  Calcium signaling pathway
fch04114  Oocyte meiosis
fch04140  Autophagy - animal
fch04261  Adrenergic signaling in cardiomyocytes
fch04270  Vascular smooth muscle contraction
fch04310  Wnt signaling pathway
fch04340  Hedgehog signaling pathway
fch04371  Apelin signaling pathway
fch04530  Tight junction
fch04540  Gap junction
fch04910  Insulin signaling pathway
fch04912  GnRH signaling pathway
fch04914  Progesterone-mediated oocyte maturation
fch04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102052736 (PRKACB)
   04310 Wnt signaling pathway
    102052736 (PRKACB)
   04340 Hedgehog signaling pathway
    102052736 (PRKACB)
   04371 Apelin signaling pathway
    102052736 (PRKACB)
   04020 Calcium signaling pathway
    102052736 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102052736 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102052736 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102052736 (PRKACB)
   04540 Gap junction
    102052736 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102052736 (PRKACB)
   04912 GnRH signaling pathway
    102052736 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    102052736 (PRKACB)
   04916 Melanogenesis
    102052736 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102052736 (PRKACB)
   04270 Vascular smooth muscle contraction
    102052736 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102052736 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fch03019]
    102052736 (PRKACB)
   03036 Chromosome and associated proteins [BR:fch03036]
    102052736 (PRKACB)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102052736 (PRKACB)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: AGC group
  PKA family
   102052736 (PRKACB)
Messenger RNA biogenesis [BR:fch03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102052736 (PRKACB)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102052736 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102052736
NCBI-ProteinID: XP_005445564
LinkDB All DBs
Position
Unknown
AA seq 398 aa AA seqDB search
MAAQKEVPCNQCTGTATALQRLEGFANRLFHRHSKSGVHEQRTALENESHHCSELAVLWD
KSMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcagaaggaggtaccttgtaaccagtgcacagggacggccacagcactgcag
agactggaaggttttgctaatcgccttttccataggcattcgaagagtggtgtgcatgaa
cagagaacggctctggaaaatgagagccatcattgctctgaacttgctgtcctatgggac
aaatcaatgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccccctcagaatactgctggcctagatgattttgagaggcaaaaaacccttggaacagga
tcatttgggagagttatgatggtgaaacataaatccacagagcagtattatgctatgaag
atactggacaaacagaaggtcgtcaaactgaagcaaatagaacacacactgaatgagaag
agaatattacaagcagtgaactttcctttccttgtaaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggtgagatgttttcacatcta
agaagaatcggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggaagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcattaggagtgttaatctatgaaatggca
gctggatatcccccattctttgcagatcagcccattcaaatttatgagaagattgtgtct
ggcaaggtaaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacggtatggaaatctcaagaatggtgtaaatgacataaag
aatcacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaggct
ccgttcataccaaagtgcagaggccctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcgtctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system