KEGG   Falco cherrug (Saker falcon): 102053036
Entry
102053036         CDS       T02911                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
fch04115  p53 signaling pathway
fch04218  Cellular senescence
fch04310  Wnt signaling pathway
fch04340  Hedgehog signaling pathway
fch04371  Apelin signaling pathway
fch04510  Focal adhesion
fch04530  Tight junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102053036 (CCND1)
   04340 Hedgehog signaling pathway
    102053036 (CCND1)
   04371 Apelin signaling pathway
    102053036 (CCND1)
   04068 FoxO signaling pathway
    102053036 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102053036 (CCND1)
   04115 p53 signaling pathway
    102053036 (CCND1)
   04218 Cellular senescence
    102053036 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102053036 (CCND1)
   04530 Tight junction
    102053036 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102053036
NCBI-ProteinID: XP_005446161
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctagatgcc
aacctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgttggaggtctgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccacct
tccatgatcgcagctggcagcgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgt
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system