KEGG   Falco cherrug (Saker falcon): 102053189
Entry
102053189         CDS       T02911                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04310  Wnt signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04916  Melanogenesis
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102053189 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102053189 (CTNNB1)
   04520 Adherens junction
    102053189 (CTNNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102053189 (CTNNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102053189 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 102053189
NCBI-ProteinID: XP_005443223
LinkDB
Position
Unknown
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRPDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggcaactcaagctgatttgatggagttggacatggcaatggagccagacagaaaagca
gcagtcagtcactggcagcaacaatcgtatctggactctggtatccattctggtgccacc
acaactgctccctccttgagtggcaagggaaatcctgaagaggaagatgtggacacgaca
caagtgctgtatgagtgggagcagggattctcgcagtccttcacccaggagcaagttgct
gatattgatggccagtatgcaatgactagagctcagagagtgcgtgcagctatgttccct
gaaacactggatgaaggaatgcaaatcccatccacgcaatttgatgctgctcatccaact
aatgtgcaacgcctggctgagccgtcccagatgttaaaacatgctgttgttaatttgata
aactaccaagatgatgctgaactcgcaactcgtgcaatcccagaactgaccaaactgttg
aatgatgaggaccaggtagtggtgaacaaagctgcagttatggttcatcagttatccaaa
aaggaagcatctcgccatgctattatgagatctcctcaaatggtatctgctattgtacgt
accatgcaaaacacaaatgatgtagaaacagcccgttgcactgcaggtacgctacacaat
ctctcacatcaccgtgaaggcttgttggcaatcttcaaatcaggaggcatccctgctttg
gttaaaatgcttgggtccccagtggactctgtgctgttctatgccattacaactcttcac
aatctcctgttacaccaggaaggagccaaaatggctgtccgtctagctggtgggctgcag
aagatggttgccttgctcaacaagacaaatgtcaaattcctggccatcacgacagactgc
cttcagattttagcgtatggcaatcaagaaagtaagctgattattctggcaagtggtgga
cctcaggctctagtaaacataatgaggacctatacttacgagaaactattgtggaccaca
agtagggtgctgaaggtgttgtcagtctgctccagcaacaaacctgctattgttgaggct
ggtgggatgcaagctttgggtctccacctcacagatccaagccagcgtcttgtccagaac
tgtctctggactctgagaaatctgtcagatgctgcaacaaagcaggagggcatggaaggt
cttctaggaactcttgttcagcttttaggatcagatgatattaatgttgtgacttgcgct
gctggcatcctttctaatctcacctgcaacaattacaagaacaagatgatggtgtgccag
gttggtggcattgaggctcttgtgcgcacagttcttcgggctggagacagggaagacatc
acagaacccgctatttgtgcgctccgtcacctcaccagcagacatcaagaagctgagatg
gctcaaaacgcagtacgtctccattacggactcccagtagtggttaaactgttgcacccg
ccctcacactggcctttgatcaaggctactgttggtttgatccgcaatctggcgctctgt
cctgcaaaccatgccccactgcgtgaacaaggtgctattccaaggctagttcagttgctg
gttagagcacatcaggatacccagcgacgtacttctatgggtggaacacaacagcagttt
gtggagggcgtgcgtatggaagaaattgtcgagggctgcactggagccctgcatattctt
gcacgtgatgttcataatcgaatcgtaatcaggggtctaaataccattccactatttgtg
cagttgttgtactctcccattgagaatatccagagagtagctgcaggtgtactttgtgaa
ctggctcaagacaaggaagcagctgaagcaattgaagctgaaggtgcaactgccccttta
acagaactgcttcattctaggaatgagggtgttgcaacatacgcagctgcagtgctgttc
aggatgtctgaggacaaaccacaagactataagaagcgactttcagttgaattgacaagc
tctctgttccggactgagccaatggcttggaacgagacagcagatctcggacttgatatc
ggtgcccagggagaacctcttggataccgcccagatgatcctagctaccgttctttccac
tctggcggatacggtcaggatgccttgggtatggaccctatgatggaacatgaaatgggt
ggccaccaccctggtgctgactacccagttgatggtctgccagatcttggccatgcccag
gaccttatggatgggctgcctccaggtgacagtaatcagttggcctggttcgatactgac
ctgtaa

DBGET integrated database retrieval system