KEGG   Falco cherrug (Saker falcon): 102053227
Entry
102053227         CDS       T02911                                 

Gene name
TJP1
Definition
(RefSeq) tight junction protein ZO-1 isoform X1
  KO
K05701  tight junction protein 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch04530  Tight junction
fch04540  Gap junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102053227 (TJP1)
   04530 Tight junction
    102053227 (TJP1)
   04540 Gap junction
    102053227 (TJP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102053227 (TJP1)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     102053227 (TJP1)
SSDB
Motif
Pfam: PDZ ZU5 PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1 RPOL_N
Other DBs
NCBI-GeneID: 102053227
NCBI-ProteinID: XP_027658554
LinkDB
Position
Unknown
AA seq 1744 aa
MEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGLLQEN
DRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRMKKIQIPVARPEPEPVSENEDDSY
DEEICDPRSSRGGPSANRRHEKSWVRDRSASRERSLSPRSDRRSVTSSQPTKPTKVTLVK
SRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLADAKTLIER
SKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSNRSHDRPRRSR
SRSPDQRSEPSDHSRHSPQQPSNGSHRSREDERVTKPGAVSTPVKNADDLSKTVEEVAVE
RTEKQTPPLPEPKPVYAQGGQPDVDLPVSPSDGPLPNSTHEDGMLRPSMKLVKFRKGDSV
GLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPKG
EEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGK
LGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRN
LRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIFQIAK
SEPRDAGTDQRSSGIIRLHTIKQIIDRDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSK
QGVKTMRMRLCPESRKSARKLYERAHKLRKNNHHLFTTTINLNSMNEGWYGALKEAIQQQ
QNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAY
TDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHETQTYPTYASQAQPQPNLRIDSS
GFKTTASQPKAEASPAVPYLSPSPESNPATSSTSAVNANVNLTNVRLEEPTAAPYNSYQP
QAGPLRTSSTEGAHIVLRDQEPSSLSPHIDPAKVYRKDPYINEEASRQSYILKQPAINHP
VQRQERDPNLIYESQAQYAEKQPSRDYEQSTYRYDSTNYVDQFSRGYDPRLHYDDRVPPY
EEHWAYYDEKQPYNQARTAYENQPPRDLDSRQNIEESTERSYYPAQPRFEEPPPMSYEGR
PRYEHAPKNFSLPQVRYEDQHSVGYDTHGRYKQEAQPYQSAISRSPEPKQYFDPHIRGYE
QGGPQAYNAKAGQYEPSHSTSGVSLPPPPSSQTKPEVLPSNSKPLPTPPSLAEEEEDPAM
KPQSVRSRVKIFERRRSPSLEKMKDPSDTSAVKPPELAPKPTLATVSGPKPTSQSQYEHD
KTTYRAPEPQRPQVKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPSAQVPASHH
SEPTKPIHSQSQLNFTSYSKGKTTDAESMDRPVGEKRYEPIPQVTTPPPAPSVQYTQPQS
INSPVLSLPAHHKPALSEVNSVSDPPPPQNKPAIFRSSREDTVQSTFYPQKSFPDKGPVN
GTEQIQKTVTPSYNRFTTKPYTSAARPFERKFESPKFNHNLLPNEAQHKPELPSKSPNSP
QPILKAHSSSQPPEFDSGMDTFAVQVDKPKYQPNNVNAVPKAIPVSPSALEDEEEEDGHT
VVATARGVFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGE
TLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGDPKTWQNKSLPGDPNYLVGANCVSVL
IDHF
NT seq 5235 nt   +upstreamnt  +downstreamnt
atggaagaaacagctatatgggaacaacacacagtgactcttcacagggccccaggattt
ggatttggtattgcaatatctggaggaagagataatcctcactttcagagtggtgagaca
tcaatagttatttctgatgtgctgaaaggaggcccagcagaaggactgctacaagaaaat
gaccgtgttgcaatggttaatggagtttcaatggacaacgtggagcatgcatttgctgtt
cagcagctgaggaaaagcgggaagaatgccaaaattactatacgaaggatgaagaaaatt
cagattccagtggctcgaccagaacccgaaccagtgtctgaaaacgaggatgatagctat
gatgaagagatatgtgatccgagaagcagccgtggtggtcctagtgccaacagaaggcac
gagaagagctgggtaagagatagaagtgctagcagagaaaggagcttatcaccgagatca
gacagaaggtctgttacttccagtcagcctacaaaacctaccaaagtaacactggtgaaa
tcgaggaagaacgaagagtatggtctacggttggcaagccacatatttgtgaaagaaata
tcacaggatagcttggcagcgagagatggcaatattcaggagggagacgttgtactgaag
ataaatggcacagtgacggaaaatatgtccttagcagatgcaaaaacactaatagaaagg
tcaaaaggcaagttgaagatggttgttcagcgagatgaacgagctacgctgttgaatgtc
cctgatctttctgacagtattcattctgctaatgcttcagaaagagatgacatttcagaa
attcagtcgctggcatcagatcattccaaccgatcacatgacaggccccgccgcagtcgt
tcacgatctcctgaccagaggtcagagccttcagaccattccagacattctccacagcaa
cccagcaacggcagtcatcgaagcagagaagatgagagagtaactaaaccgggagctgtc
tctacacctgtaaagaatgcagatgatctttctaaaactgtagaagaggtggcagttgaa
agaactgaaaaacaaactccaccactaccagaaccaaagccagtgtatgcacaaggaggt
cagccagatgtggatttaccagtcagtccatctgatggtcccttacccaattcaacccat
gaagatggaatgcttcggccaagcatgaaactggtaaaattcagaaaaggagacagtgtg
ggcttgcgactagcaggtggcaatgatgttggcatatttgtagctggcgttctggaagac
agccctgcagcgaaagaaggattagaggaaggggaccagattctcagggtaaataacgta
gacttcacaaatatcatcagagaagaagctgtcctttttttgcttgatcttcctaaaggc
gaagaagtaaccattttggcacagaagaaaaaagacgtttatcgtcgcattgttgagtct
gatgtaggggattctttctatatcagaactcactttgaatatgaaaaggaatctccttat
ggattaagtttcaacaaaggtgaagtgttccgggtggtagacactctgtacaatggcaaa
ctaggttcttggctggcaattcgaattggcaagaatcacaaggaagttgaaagaggtatc
atacctaacaaaaacagagctgagcaactagctagcgtacagtacacgcttccaaagacg
gcaggaggagatcgagcggatttttggagattccgaggtttgcgtagctcaaaaagaaat
ctccgaaaaagcagagaagatctgtctgcccaacctgtgcagacaaagtttcctgcctat
gaaagagttgttcttcgggaagctggatttctcagacctgtaaccatttttggtccaata
gctgacgttgcgcgagagaaacttgctagagaagaaccagatatctttcaaattgcaaag
agcgaaccaagagatgctggcactgaccaacgtagttctggcattattcgtcttcacact
ataaaacagataatcgatagagacaaacatgctttattagatgtcactcctaatgcagtg
gaccgtctgaattatgcccagtggtatcctattgtcgtgttcctaaatcctgattctaag
caaggtgtaaagacaatgagaatgaggttgtgcccagaatcacgaaaaagtgccagaaag
ctgtatgaaagagctcataagctacgcaaaaataatcaccatctctttacaactaccatt
aacttgaactcaatgaatgaaggatggtatggagctctaaaggaagcaattcagcaacaa
cagaaccaactagtgtgggtttcagaaggaaaggcagatggtgctacgagcgatgacctt
gatttgcatgatgaccgcctttcttacctctcggctcctggtagcgaatattctatgtat
agcacagacagcagacacacatcggattatgaagacacagatacagaagggggtgcttac
actgatcaagaactggatgaaactctgaatgatgaggttgggactcctcctgaatctgct
attacacgttcttctgaacctgttagagaggattcttctggaatgcatcatgaaactcaa
acttaccctacttatgcatctcaagctcagccacagcctaatctcagaatagattcttca
ggatttaaaacaactgcttctcagccgaaagcagaagcttcacctgcagtcccttacctt
tccccgtcgcctgaatcaaaccctgcaacctcatcaacctctgcagtaaatgctaatgta
aacctaactaatgtcagactggaggagcctaccgctgctccttacaactcttaccaacca
caggcgggccccttaagaacatcaagtactgagggagctcatatagtcctaagagatcaa
gagccatcatccttatcgccgcatatagatccagcaaaggtataccgaaaggatccatat
attaatgaagaagcgtccagacaaagctacatcttaaaacagccagcaattaatcaccca
gtacagagacaggaaagagacccaaatctgatctatgaatcccaggctcagtatgcagaa
aaacaaccaagtagggactatgaacagtcaacatacagatatgactctacaaactatgta
gatcaattttctcgtggttatgaccctcgcctacattatgatgaccgcgtgcctccctat
gaggagcactgggcatattacgacgaaaaacagccctacaaccaagcaagaacagcttat
gaaaaccagcctcctagggatcttgattccagacaaaacatagaagagagcacagaacgc
agctattacccagcacaacctcgttttgaggaaccccctccaatgagctatgaaggcaga
cctcgctatgagcatgcacccaaaaacttcagcttaccacaagtgcgatacgaagatcag
catagtgttgggtatgacacacatggtagatacaaacaagaagctcagccataccagtca
gccatatcgcgatctcctgaaccgaagcagtactttgacccgcatataaggggctatgaa
caaggtggtcctcaagcatataatgcgaaagctggacagtatgagccttctcatagcact
tcaggtgtttcccttcctcctcccccttcatcacaaaccaaaccagaagttttgccttct
aacagtaaaccactgcctacaccgccatctctagcagaggaagaagaagatccagccatg
aaaccccagtctgtgcgaagtagggttaagatattcgaaagaagaagatcgccatctttg
gaaaaaatgaaggacccgagtgacacatcagctgtcaagcctccagaactagcacctaag
cctacactcgcaactgtgagtggtccaaaaccaacttctcaaagccaatacgaacacgac
aaaacaacttacagggccccagaaccacagagacctcaagtgaagcctcctgaagatatt
gtgcgttcaaatcattatgatcctgaggaagatgaagagtattaccgaaagcagctctca
tattttgatcgcaggagttttgaaaataagccatctgcacaggttcctgccagccatcat
tctgagcctactaagccaatacattcgcagagtcagctgaatttcactagttattctaag
gggaaaacaaccgatgctgaatcaatggatagacctgttggtgaaaaacgctatgagccg
atccctcaagttacaactcctcctcctgctccttcagtccagtatacacaaccccagtcc
atcaatagtcctgtcctgtctctcccagcacaccacaagcctgcactttccgaagttaac
tctgtgtcagaccctcctccacctcagaataagccagcaattttcagatcctcgagagag
gacactgtgcagtccacgttttatcctcagaaaagcttccctgacaaaggccccgtgaat
ggaactgaacagattcagaaaacagtcactccttcttacaaccgctttacaacgaaacct
tacactagtgctgcaaggccctttgagcgcaagtttgaaagtcctaaattcaaccataat
ctcttgccaaatgaagctcaacataaaccagagttgccatcaaaatctccaaattctcct
caaccgattttgaaagcacacagctcatcgcagcctcctgagtttgatagtggaatggat
acctttgctgtacaggtcgacaagcctaaatatcaaccaaataatgttaatgctgtgcct
aaagccattcctgtaagcccttcagcactcgaggatgaggaggaagaagacggacacact
gttgtggccacagcaagaggtgtatttaacagcaatggcggtgtgttgagctccatagag
actggagttagtattattataccacaaggagccatcccagagggaatagagcaagaaata
tatttcaaagtttgcagagacaacagcatacttccacctttggacaaagagaaaggtgaa
acccttcttagccccttggtaatgtgtgggccccatggactgaaattcctgaagccagtg
gagctgcgcctgccacattgtgcgtctatgacccctgatggtgaccccaaaacctggcag
aacaagtctcttcccggggatccaaactatcttgttggagcaaactgtgtctcagtccta
attgaccacttctaa

DBGET integrated database retrieval system