KEGG   Falco cherrug (Saker falcon): 102053375
Entry
102053375         CDS       T02911                                 

Gene name
SSX2IP
Definition
(RefSeq) afadin- and alpha-actinin-binding protein isoform X1
  KO
K06085  synovial sarcoma, X breakpoint 2 interacting protein
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102053375 (SSX2IP)
SSDB
Motif
Pfam: ADIP Sulfatase_C DUF3775
Other DBs
NCBI-GeneID: 102053375
NCBI-ProteinID: XP_027670238
LinkDB
Position
Unknown
AA seq 552 aa
MGDWKTITVPVLSSDSKNIFQYTSEKKISCPSMNSQVLCLPLLSSKSMHSFYSAFCTEEN
IEQSISYLNRELTTLGFPSIYAESKGKELNLISIINCMNELLVLQHKNLRAQEEVEMQHL
KLGSDMDHLQNCYTKLKEQLESSKREIVGLQERDRQLQSKNRNLHQLLKNEKDEVQKLQN
IISSRATQYNHDMKRKEREYNKLKERLHQLVMNKKDKKITMEVLNYVGRADGKRSAWRTD
KTDARNEEEMYKVLLSDYEQRQKQLLMENAELKKVLQQMKKEIISLLPPQKQKPKERSED
GPVLSDLEEDIGELKENMWELSCETVREQLTNSIRKQWRMLKNHVEKLDNQVSRVHSGAL
DEKDVISREDHELETEKLELEIQQCKEMIKTQQQLLQQQLMSPCDDDTTLLLQDCYLLEE
RERLQEEWRLFREQKKNFEKERRSFTEAAIRLGLERKAFEEDRGAWLKQQFLSMSTDYKH
SENVTTPSAFLGSSDQDNRLVKSTSQRKPHCMLSGPVSAEPCQTSRSSAASKKPAADSKP
NQWVESDKEEAE
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgggagattggaagactattactgtgccagtgctgtcatcagatagcaaaaatattttt
caatatacctcagaaaaaaagatatcttgcccaagcatgaactcacaagtgctatgcttg
ccactgctttcatctaaaagcatgcacagcttttatagtgccttctgcacagaagagaat
attgaacagagtatatcctatctcaatagggaattgacaacattgggctttccttctatt
tatgccgagtccaaaggaaaagaattaaatttaatatctatcataaattgcatgaatgaa
ttgcttgtactgcagcacaagaaccttcgagctcaggaagaagtagaaatgcagcatctg
aaactgggtagtgatatggatcacttacagaactgctatactaaactaaaggaacagctg
gaatcatctaaaagggaaatagttggacttcaggaaagagacagacaactgcaaagcaag
aaccgaaatttgcaccagttacttaaaaatgaaaaggatgaagtacagaagctacagaac
ataatttcaagtagagctacacagtacaatcatgatatgaagaggaaagagagagagtat
aacaaattaaaggaacgtttacatcaattagtcatgaacaaaaaggacaaaaagataact
atggaagttctaaattatgttggtagagctgatgggaagagaagtgcatggaggactgat
aagacagatgccagaaatgaagaggagatgtacaaagttctattaagtgattatgaacaa
cgccaaaaacagcttttgatggaaaatgctgagctgaaaaaagttcttcagcagatgaag
aaagagattatttcacttctcccaccacagaaacagaaacctaaagaaaggtctgaagat
gggccagtgctgtcagatctggaggaagatattggagagttaaaagagaatatgtgggaa
ctgtcctgtgaaactgtcagagagcagcttaccaacagcattagaaaacaatggagaatg
ctgaaaaatcatgttgaaaagctggataaccaagtgtcacgtgtacattcaggagctttg
gatgaaaaagatgtcatttcaagggaagaccacgagctggaaactgaaaagctggaatta
gagattcagcaatgtaaagaaatgatcaaaactcagcaacagctcttacagcagcagctt
atgtctccatgtgacgatgacaccactctgttactacaggactgctatttgttggaagaa
agagagcgtcttcaggaagaatggagactatttcgagaacaaaaaaagaattttgagaaa
gaacgaagaagtttcacagaagctgctattagattaggacttgagagaaaggcatttgaa
gaagatagaggagcgtggctgaagcaacagttcttaagtatgtctactgattacaagcac
tctgaaaacgtgacaactccaagtgccttcctaggaagttctgaccaagacaataggtta
gtgaaatctacatctcaaagaaaacctcactgtatgttgagtggtcctgtttcagcagaa
ccttgccagacatctcgttccagtgctgcatcaaaaaaacctgctgcagatagcaagcca
aatcagtgggtggaaagcgacaaagaagaagctgagtaa

DBGET integrated database retrieval system