KEGG   Falco cherrug (Saker falcon): 102053408
Entry
102053408         CDS       T02911                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04068  FoxO signaling pathway
fch04217  Necroptosis
fch04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102053408 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102053408 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102053408 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102053408 (STAT3)
Transcription factors [BR:fch03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102053408 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Baculo_PEP_C Syntaxin-6_N Fib_alpha
Other DBs
NCBI-GeneID: 102053408
NCBI-ProteinID: XP_005439505
LinkDB
Position
Unknown
AA seq 772 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLHTAA
AAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTXXXXRVVESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSF
SNTIDLPMSPRTLDSLMQFGNNSEGAEANAGGQFESLTFDMELTPECASSPM
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcggtacctggagcagctccaccag
ctctacagcgacagctttcccatggagctccggcagttcctggccccgtggattgagagc
caggactgggcgtacgctgccagcaaggagtcgcatgccacgctggtgttccacaacctg
ctaggggagatcgaccagcagtacagccgcttcctgcaggagtccaacgtcttgtaccag
cacaacctgcggcgcatcaagcagttcctgcagagcagatacttggagaagccgatggaa
atagcccgcatcgtggcccgctgcctgtgggaagagtcccggctcctccacacggctgct
gcagcagcccagcaagggggacaggcaacacatcccacggcggcggtagtgaccgaaaag
cagcagatgctggagcagcatctgcaggatgtgaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaatcagtccgtgacccggcagaaaatg
cagcagctggaacagatgctcacggcgctggaccaaatgcgaaggggtattgtgagcgag
ctggccgggctgctgtcagccatggagtacgtgcagaagatgctggcagatgaggaattg
gcagactggaagaggcggcagcagatcgcctgcattggcggcccaccgaatatctgttta
gaccggcttgagaactggataacctctcttgccgaatcacagctacaaacccggcagcag
atcaagaagttggaagaactgcagcaaaaagtgtcttacaagggtgacccaattgtccaa
caccggcccatgctggaggagcggattgtggagctcttcaggaacctgatgaaaagtgct
tttgtcgtggagaggcagccctgcatgcccatgcaccccgaccggcccctggtcatcaaa
actggggtgcagttcaccaccaaagtcaggttgttggtcaagtttccagagctgaactat
cagctgaaaattaaagtctgcattgacaaggactccggggatgttgcagcacttcggggg
tcgcggaagtttaacatcctggggacaaacaccaaagtcatgaacatggaggagtcgaac
aacggcagcctctcagcagagttcaagcacctgaccctgcgggagcagcggtgtggtaat
ggaggcagagccaactgcgatgcctcgctgatcgtcaccgaggagctgcacctcatcacc
tttgagacagaggtgtatcaccagggtctgaagatcgacctggagacccactcgctgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaatgtgaacttcttcaccaagccccccatcgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccacaaagcgcggcctc
agcatcgagcagctgacgacgttggcagaaaaacttctagggccaggtgtgaattactct
ggctgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctct
ttctgggtctggctggacaacatcattgacttggtgaaaaagtacatcctggcgctgtgg
aacgaagggtacatcatggggttcatcagcaaggagcgggaacgagccatcctgagcacc
aagcccccgggaaccttnnnnnnnnnncgggtcgtcgagagcagcaaggaaggcggcatc
accttcacatgggtggagaaggacatcagtgggaagacccagatccagtctgtggagcct
tacaccaagcagcagctgaacaacatgtcgtttgcggagatcatcatgggctacaaaatc
atggatgccaccaacatcctggtgtcccccctggtgtacctgtacccagacatccccaag
gaggaggcgtttgggaagtactgccgctctgagagccaggagcactctgaagctactgac
tcaggtagtgctgctccgtatctgaagaccaaattcatctgcgtcacccccacctccttc
agcaacaccatcgacctgcccatgtccccgcgcaccctggactcgctcatgcagttcggc
aacaacagcgagggagcagaggccaacgcgggggggcagttcgagtcgctgaccttcgac
atggagctgaccccggagtgtgcgtcttcacccatgtga

DBGET integrated database retrieval system