KEGG   Falco cherrug (Saker falcon): 102053568
Entry
102053568         CDS       T02911                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
fch04144  Endocytosis
fch04218  Cellular senescence
fch04310  Wnt signaling pathway
fch04350  TGF-beta signaling pathway
fch04371  Apelin signaling pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102053568 (SMAD3)
   04350 TGF-beta signaling pathway
    102053568 (SMAD3)
   04371 Apelin signaling pathway
    102053568 (SMAD3)
   04068 FoxO signaling pathway
    102053568 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102053568 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    102053568 (SMAD3)
   04218 Cellular senescence
    102053568 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102053568 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102053568
NCBI-ProteinID: XP_005435642
LinkDB
Position
Unknown
AA seq 426 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNI
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMEMCEYAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNYIPET
PPPGYLSEDGETSDHQMNPSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYE
LNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYI
GGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQG
FEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSI
RCSSVS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtcctccatcctgcctttcactccccccatcgtcaagcggctcctgggctggaagaag
ggggagcagaacgggcaggaggagaaatggtgcgagaaggcggtgaagagcctggtgaag
aagctgaagaagacggggcagctggacgagctggagaaggcgatcaccacgcagaacatc
aacaccaagtgcatcaccatccccagatcactagatggccggctgcaagtgtctcaccgg
aagggtcttccccatgtgatctactgccggctgtggcggtggccagaccttcatagccac
catgagctgcgtgccatggagatgtgcgagtatgcctttaacatgaagaaggatgaagtc
tgtgtgaatccttatcattaccaaagagtggaaaccccagtgttacctccagtgctggtg
cctcggcacacagagatcccagctgagttcccgccattagatgattatagtcattctatt
ccagagaacactaacttcccagcgggtatcgagccacagagcaactacattccagagaca
cctcctccaggctatttgagtgaggatggagaaactagtgaccaccagatgaaccccagc
atggatgcgggttctccaaacttatcaccaaaccctatgtctccagcacacaataatctg
gatctgcagcctgttacctactgcgagccagctttctggtgctcgatatcctactatgaa
ctcaaccagcgagtgggagagactttccatgcctctcagccctctatgaccgtggatggt
ttcactgacccatctaattctgaacgcttctgccttggtttactgtctaatgtgaacaga
aatgcggcagtggaactcacaagacgacacattggaagaggagtaaggctctactacatt
ggcggcgaggtgtttgccgagtgccttagtgacagtgccattttcgtccagtctcccaac
tgcaaccaacgctacggctggcacccagcaacagtttgcaagattccaccaggttgtaac
ctgaagatttttaacaaccaggaattcgccgctctcttggctcagtctgtaaatcagggc
ttcgaagctgtgtaccagctgaccagaatgtgcacgattcgaatgagctttgtcaaggga
tggggagcagaatacaggcggcagactgtgaccagtactccctgctggattgagctacat
cttaatggtcctttgcagtggctagacaaggtccttacacaaatgggctccccgagtatt
cgttgttccagtgtctcataa

DBGET integrated database retrieval system