KEGG   Falco cherrug (Saker falcon): 102053931
Entry
102053931         CDS       T02911                                 

Gene name
NLK
Definition
(RefSeq) serine/threonine-protein kinase NLK isoform X1
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04068  FoxO signaling pathway
fch04310  Wnt signaling pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102053931 (NLK)
   04310 Wnt signaling pathway
    102053931 (NLK)
   04068 FoxO signaling pathway
    102053931 (NLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102053931 (NLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102053931 (NLK)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102053931 (NLK)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102053931 (NLK)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like FTA2
Other DBs
NCBI-GeneID: 102053931
NCBI-ProteinID: XP_005439749
LinkDB
Position
Unknown
AA seq 527 aa
MSLCGTTANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHASSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAA
VKAHHHQHSQHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgtctctttgtggcacaacagccaacgcaaaaatgatggcggcttacaatggcggtacg
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttcctcacctccctcct
cctcacctccatcaccaccaccaccctcaacatcacttgcatccaggctctgcagctgcg
gtacatcccgtacagcagcatgcctcttcggcagctgcggccgcggcagctgcggccgcg
gccgcagcaatgttaaacccagggcagcagcagccatatttcccatcaccggcaccgggt
caggcccctggaccagctgcagcagccccagctcaggtacaagctgcagcagctgctgca
gttaaagcgcaccatcatcagcactcacaacatccacaacagcaactggatattgagccg
gacagacctattggatatggagcctttggtgttgtctggtcagtaacagatccacgagat
ggaaagagagttgcactcaaaaagatgcccaacgtcttccaaaatttggtctcttgtaaa
agggtcttccgggagttgaagatgttgtgtttttttaagcatgacaatgtactctctgcc
ctcgacatactccagcctccacacattgactattttgaagaaatatatgttgtcactgaa
ttgatgcagagtgacctccataagattatcgtctctcctcagccactcagctcggatcat
gtcaaagtttttctttaccagattttaagaggtctgaaatatctacattctgctggcatt
ttacatcgagacattaaaccagggaacctacttgtgaacagcaactgtgttcttaagatt
tgtgattttggattggccagggtggaagaattagatgaatctcgtcacatgactcaggaa
gttgtcactcagtattatcgagctccagaaatcctgatgggcagccgtcactacagcaat
gctattgacatctggtctgtaggctgtatctttgcagaattacttgggcgaagaatattg
tttcaggcacagagtcccatacagcagctggatttgatcacagacctgttgggaacacca
tcgctggaagcaatgaggacggcttgtgaaggcgccaaggcacatatactcaggggtcct
cataaacagccatcccttcctgtcctatatacactttccagtcaagctacacatgaagca
gttcatctcctttgcagaatgttggtctttgatccatccaaaagaatatctgctaaggat
gccttagctcacccatatctcgatgaagggcggttgcgataccacacctgtatgtgtaaa
tgttgtttttccacatctactggaagagtttatactagtgattttgaacccatcactaat
cccaaatttgatgacacttttgaaaagaacctcagttccgttcggcaggttaaagaaata
attcatcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccacggttgctcaaccatctgagatgccg
ccatctccattggtttgggaataa

DBGET integrated database retrieval system