KEGG   Falco cherrug (Saker falcon): 102054618Help
Entry
102054618         CDS       T02911                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00040  Pentose and glucuronate interconversions
fch00051  Fructose and mannose metabolism
fch01100  Metabolic pathways
Module
fch_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102054618 (SORD)
   00051 Fructose and mannose metabolism
    102054618 (SORD)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102054618 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 DUF2249 DUF281 Top6b_C
Motif
Other DBs
NCBI-GeneID: 102054618
NCBI-ProteinID: XP_005437584
LinkDB All DBs
Position
Unknown
AA seq 354 aa AA seqDB search
MGSLMCMHQISEEELGESKENRPVPEPGPNEVLLRMHSVGICGSDVHYWQHGRIGDFVMK
DPMVLGHEASGTVVKVGSGVTDLKPGDRVAIEPGVPREMDEFCKTGRYNLSPTIFFCATP
PDNGNLCRYYKHSASYCYKLPDNVTFEEGALIEPLSVGIHACKRAGVTLGSKVFVSGSGP
IGLVNVLVAKMMGAAAVVITDLSASRLQKAKEVGADFTIQVKNETPKEVAFKVESLLGCM
PEITVECTGVEACIQAGIYATRSGGTLVLVGLGPEMVTVPIVNAAVREVDIRGIFRYCNT
WPVAIALLASKRINVKPLVTHRFPLEKALEAFETTKRGEGVKVMLKCDPTDHNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctcactaatgtgtatgcaccaaatttctgaagaggaactgggtgaatcgaaggaa
aaccgtccagttccggaaccgggtcccaatgaggtcctcctgcggatgcattctgttggg
atctgtgggtctgatgttcactactggcagcatggtcgaattggggattttgtcatgaag
gaccccatggtattggggcacgaagcttctgggactgttgtcaaagtgggatcaggggtg
actgatctgaaaccaggtgatcgagtggccattgagcctggtgtcccaagagaaatggat
gagttctgcaaaactggccgctataacctgtctccaaccatcttcttctgcgcgacgcct
cctgataatgggaacttgtgccgctactacaagcacagtgccagctactgctacaagctt
ccagataatgtcacctttgaagaaggagcccttattgagcctctttcggtgggaatccat
gcctgcaaaagagcaggagtcactctgggaagcaaagtctttgtgtctggctctggacca
attggccttgttaatgtgcttgttgctaagatgatgggtgcagcggctgtggtaattact
gatttatctgcatctcgccttcaaaaagccaaggaggtgggggcagatttcaccattcag
gtgaagaatgagaccccgaaggaggtggccttcaaagtggaaagtctgcttggctgcatg
cccgagataactgtggagtgtacaggagtggaagcctgcatccaggctggcatttatgcc
actcgttctggtgggaccttggtgctggtggggctggggcctgagatggtcactgtgccc
atcgtgaacgctgccgtgcgagaggtggatatccgggggatattccgctattgcaacacg
tggcctgtggcaattgcgctgctcgcatccaagcggatcaatgtcaagcctttggttaca
caccgttttcccctggaaaaggctcttgaggcatttgagaccaccaagaggggtgaaggg
gtcaaagtcatgttgaagtgtgaccccactgaccacaacccctga

DBGET integrated database retrieval system