KEGG   Falco cherrug (Saker falcon): 102054787
Entry
102054787         CDS       T02911                                 

Gene name
IQGAP1
Definition
(RefSeq) ras GTPase-activating-like protein IQGAP1 isoform X1
  KO
K16848  Ras GTPase-activating-like protein IQGAP1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102054787 (IQGAP1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102054787 (IQGAP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102054787 (IQGAP1)
   04147 Exosome [BR:fch04147]
    102054787 (IQGAP1)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     102054787 (IQGAP1)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102054787 (IQGAP1)
  Exosomal proteins of breast milk
   102054787 (IQGAP1)
  Exosomal proteins of other body fluids (saliva and urine)
   102054787 (IQGAP1)
  Exosomal proteins of colorectal cancer cells
   102054787 (IQGAP1)
SSDB
Motif
Pfam: RasGAP RasGAP_C IQ CH WW bZIP_1
Other DBs
NCBI-GeneID: 102054787
NCBI-ProteinID: XP_005437500
LinkDB
Position
Unknown
AA seq 1664 aa
MASLCDKEGRLKRRGVFYCLQRIAVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWME
ACLSEELPPTTELEEGLRNGVYLAKLGNFFSPKVVSVKKIYDREQTRYKATGLHFRHTDN
VIQWLNAMAEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKV
DFTEEEISNMRLELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDHQVPAD
TLMAMKNPNAMLINLDDQLESTYQDTLYRAKQDKTENAKNRIASENSERERDVYEELLTQ
AEIQGNINKVNTHAAISKIDLALEQGDALALYEAMATPALGLRGLLRENCDWYFKQFLSD
RQQKQEAGLTGPLQKEELQLGVDAANRAAQQYQQRLAAVARINSAIRMGDAEKTVAELMN
PEAQLPEVYVFAADLYQRELATLQQQSPEGNLTHPELSVAVEMLSSVALINRALDSGDVN
TVWKQLSSPVTGLTNIEDENSQRYIDDLMKLKAQARAEGNEFITWNDIQSCVDRVNIAVH
EEHERILAIGLINEALDEGDSKKTIQALQIPAAKLEGVAPKVAQHYQDTLLRAKREKAQD
TQDETAVLWLDEIQDGIHRANKDTEESERFSLGILAINEAVDHGVVSQTLSALRSPDVGL
YGVTPECAETYQRELSEVKRRKMAAGGNGSEWVKHWVRGGYHYYHNLRTKEGGWDEPAEF
VQNDTQLSREEIQSTISGVTAAYNREQLWLANENLITKLQACCRGYLVRQEFNSRMNFLK
KQVPAITCIQSQWRGYKQRKAYQIRLDYLRAQKDQVVKIQSMTRMYQARRRYRDRLQYFR
NHINDVIKIQAFIRANKAREDYKTLINAENPPMAVVRKFVHLLDQSDQDFQEELELMKLR
EEVVTLIRSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMLNK
QRGGLKALSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYA
SNQREEYLLLRLFQTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILA
PVVKEIIDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALNHEEVRTRLDA
SIRNMRTVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHDKFPDAGEDELLKIVGNLLYY
RYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFMGDNAHLSIINE
YLSQSYQKFRRFFQAACEVPELQDKFNIDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQ
DAIAPEHNDPIHELLDDLGEVPTIESLIGEGSGNVNDPNREMLAKTEVSLTLTNKFDVPG
DENAEMDARTILLNTKRLIVDVIRFQPGETLSEILETPATSEQEVEHQRAMQKRAIRDAK
TPDKMKKSVSVKEDGNLNLQEKKDKIKIGLKKLTELGTVNAKNKYQELINDIAKDIRNQR
RYRQRRKAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKG
KNSKKISLKYTAARLHEKGVLLEIEDLQSNQFKNVIFEISPTEEVGDFEVKAKFMGVQME
TFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
NT seq 4995 nt   +upstreamnt  +downstreamnt
atggcaagtttgtgtgacaaggaaggaaggctaaagagacgaggtgtcttctattgcttg
caaagaatagctgtcttggataatgagaggttaacagcagaggaaatggatgaaagaaga
cgccagaatgttgcctatgaatacctttgtcatctggaggaagcaaagagatggatggag
gcctgtctgagtgaggagctgcctcccacaacagagctggaagaaggattgagaaatgga
gtctacctggccaaacttggaaacttcttctcccctaaagtagtttctgtgaagaaaatc
tatgatagggaacagactagatacaaggcaactggtctccacttccggcacacagataac
gtaatccagtggctgaatgccatggctgagattggtctccccaagatattctacccagaa
actacagatatctatgatcgcaagaacatgccacgctgtatctattgtattcatgcactc
agcctgtacctgttcaaactgggtcttgcccctcagattcaggatttatatgggaaggtg
gacttcacagaggaggaaatcagtaacatgaggcttgaactggagaagtatggtattcag
atgcctgccttcagcaagattggtggaattcttgcaaatgaactttctgtggacgaagca
gcattacatgctgctgtcattgccattaatgaagcaatcgaccatcaggttccagctgac
actctcatggccatgaagaaccctaatgccatgctaataaatcttgatgatcaactggaa
tccacttaccaagacacactctacagagcaaagcaagacaagacggagaatgctaaaaac
aggattgcctctgaaaattcagagagagagagagatgtgtatgaggaacttttgactcaa
gctgaaattcagggaaacatcaataaagtgaacacacatgcagccatatcaaagattgac
ctagctttggaacaaggagatgcattagcactgtatgaagctatggcaacgccagccctg
ggactccgaggattgctacgtgaaaattgtgactggtatttcaagcagtttttgagtgac
agacaacagaaacaggaggctggccttacaggtcctctgcagaaggaagagttgcagctg
ggagtggatgctgctaacagggcagcgcaacagtatcagcaaaggctggcagcagtagcc
agaattaattctgcaattcgaatgggtgatgctgagaagactgtggcagaactgatgaat
ccagaggcccagttaccagaggtttatgtatttgctgcagacctttaccaaagggagctg
gccaccttgcagcagcagagccctgaaggtaacctcacccatccagaattatctgttgct
gtagagatgctgtcttctgtggccctgattaatagggctttggattcaggggatgtgaat
acagtgtggaaacagctgagcagtcctgtcacagggcttacaaacattgaggatgagaac
tctcagagatacatcgatgatttgatgaagctgaaagctcaagcacgtgcagaaggaaat
gaattcatcacatggaatgatatccagtcatgtgttgatcgtgtgaacatagctgtgcat
gaagaacatgaaaggattttggcaattggtcttatcaatgaagctctggatgaaggggac
agcaaaaagactattcaagccttgcagattcctgcagcaaaattggagggtgtagcccca
aaggtagcacagcattaccaggatacactacttcgagccaagcgagagaaagcacaggac
acacaggatgaaacagctgtgctttggctagatgaaattcaggatgggattcatagggct
aacaaggacacagaggagtcggagcgattctccttaggaattctggccattaacgaagca
gtagaccatggtgttgttagccagaccctgagtgccttgcgttcacctgatgttgggctg
tatggagtcactccagaatgtgccgagacgtatcagcgagagctgtcagaagtcaagaga
agaaaaatggcagcagggggcaacggcagtgaatgggtgaaacactgggtgagaggaggc
tatcattattatcataacctgcggaccaaagagggaggatgggatgaaccagcggaattt
gtgcaaaatgatacacagctgtcacgggaggagatacagagcaccatatctggagtcact
gcagcatacaaccgagagcagctctggctggccaatgagaacctaattacgaagcttcag
gcttgctgtcgaggatatcttgttcgccaggaattcaactcaagaatgaattttttgaag
aaacaagtcccagcaattacttgcattcagtcccagtggcgtggctacaagcagaggaag
gcatatcaaatccgtttggattacctgcgagcgcaaaaggatcaagtagtgaagattcaa
tcaatgacgaggatgtatcaagccagaagacgttacagagatcgcctgcagtatttcaga
aaccatataaatgatgttataaaaattcaagcctttatccgagcaaacaaagcacgagaa
gactataaaaccctcattaatgctgaaaacccacctatggctgtagttcggaaatttgtc
cacttgctcgatcagagtgaccaagattttcaggaggagcttgagctaatgaaactgcgt
gaggaagttgtaaccttgatccgatccaatcagcaactggaaaatgacctcaatctcatg
gacatcaaaattggtctcctggtgaaaaacaaaattacattgcaggatgtcgtttctcac
agcaaaaagcttaccaagaagaacaaggaacagctgtctgacatgatgatgctgaacaaa
caaaggggaggtttgaaagctttgagcaaagagaagagagaaaagctggaagcctatcag
catctcttctacttacttcagactaacccaacgtacttggccaagctgatctttcagatg
cctcaaaacaaatccacaaagttcatggattccgtcatcttcacgctgtataattatgct
tccaatcaaagagaggaatacctgttgttgcggctttttcaaacagcattgcaggaagag
atcaaatcaaaagtagaccaaatacaggaaattgtgactgggaatcctactgttattaaa
atggtggtaagtttcaaccgtggtgcccgtggtcagaatgctctgaggcaaatcttggca
ccagttgtgaaggaaatcatcgatgacaaatcactcaatatcaaaactgacccagtggat
atttacaagtcttgggttaaccagatggagtctcaaactggcgaggccagcaaactgccc
tacgacgttacacctgaacaagctctaaatcacgaagaagtgaggacgcgcctggatgcc
tcaatcagaaacatgaggacagtgacagacaagttcctgtctgccattgttagttcagtg
gacaaaatcccttatggaatgcgtttcattgccaaggtactaaaagactccctgcatgac
aagttccctgatgctggtgaggatgagctgctgaagattgttggcaacttactgtattat
cgctacatgaatccagccattgtcgcaccagacgcgtttgacatcatcgatctctcagct
ggaggccagctgaccacggaccagcgccgaaaccttggctccattgcaaagatgttgcag
cacgcggcgtccaataagatgttcatgggagacaacgcgcacttaagcatcattaatgaa
tacctatcgcagtcataccagaaattcagacgtttttttcaggctgcctgtgaggttcct
gaattgcaggataaatttaatattgatgaatattctgacttggtgactctcactaaacca
gttatttatatttctattggtgaaatcatcaatacacacactttgctcttagaccatcaa
gatgcaattgctcctgagcacaacgatccaattcacgagctgctggatgatcttggagag
gttcctacgattgagtccttaataggggaagggtctggcaatgttaatgaccccaacagg
gaaatgctagcaaagactgaggtttctctcacactgactaataaatttgatgttcctggt
gatgagaatgcagagatggatgcgaggacaattctgttgaacacaaaacgtttaattgtt
gatgtaatccgcttccaaccaggggagacactgtctgaaatcttggaaactccagctacc
tcggagcaagaagtggagcatcaaagagcaatgcagaaacgagccattcgagatgctaaa
actcccgataagatgaaaaaatctgtgtctgtaaaggaagatggcaacttaaatcttcaa
gaaaaaaaagataaaatcaagataggcctgaaaaagttgacagaactggggacagtgaat
gccaaaaataaataccaggagctaatcaatgacatcgcgaaggatatccgaaatcagcgt
agataccgtcagagaagaaaggcggagctggtgaagctgcagcagacgtacagtgccttg
aactccaaagctactttttatggggaacaagtggattattacaaaagctacatcaaaact
tgcttggataacctggccagcaagggcaaagtgtctaagaaacctcgggagatgaaaggc
aaaaacagtaaaaagatttctctaaaatatacagcagctcgactccatgagaagggagtg
cttttagagattgaagacctgcaaagtaaccagtttaaaaacgtgatatttgaaatcagt
ccaacagaagaagtaggagatttcgaggtaaaagcaaagttcatgggagtacagatggaa
acctttatgttacattatcaggatcttttgcagctgcagtatgaaggcgtcgcagtcatg
aagttgtttgacagagcaaaagtgaatgtcaaccttctgatctttcttctgaataagaag
ttttatgggaagtaa

DBGET integrated database retrieval system