KEGG   Falco cherrug (Saker falcon): 102054848Help
Entry
102054848         CDS       T02911                                 

Gene name
PRSS3
Definition
(RefSeq) protease, serine 3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04080  Neuroactive ligand-receptor interaction
fch05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102054848 (PRSS3)
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    102054848 (PRSS3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fch01002]
    102054848 (PRSS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102054848 (PRSS3)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102054848 (PRSS3)
Peptidases [BR:fch01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102054848 (PRSS3)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102054848 (PRSS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102054848
NCBI-ProteinID: XP_005436994
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
MKYILFVTFVGVATAIPINAADDDKIVGGYTCAANSVPYQVSLNSGYHFCGGSLINSQWV
LSAAHCYKSRIQVQLGKHNLALSESTEQLINSAKVIRHPGYSSATLDNDIMLIKLARPAQ
LNRAVQTIPLPTSCVAPGTTCLISGWGNTLSSTDPYPDTLQCLKAPVLPSSECSEAYPGQ
ITKNMICVGFMEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQKGYPGVYTKVCNYVSW
ITATISAN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatactgtttgtcacctttgttggtgtggctactgccatccccatcaatgct
gctgatgatgacaagatcgttggaggctacacctgtgcggcgaactctgtcccctatcag
gtgtccctgaactctgggtatcacttctgtggaggttccctcatcaacagccagtgggtc
ctgtcagctgctcactgctacaagtctcgcatccaagtgcagcttgggaaacacaacctg
gcactctcagagtcgaccgagcagttgattaactcagctaaagtcatccgccaccctggc
tacagctcagcaacactggacaatgacattatgctcatcaagcttgccaggccagcccag
ctcaacagagctgtccaaaccattcctctgcctaccagctgtgtggcaccaggcaccaca
tgcctcatctccggatggggcaacactctcagcagtaccgatccctatccagacaccttg
cagtgcctgaaggctcctgtactcccctcaagcgagtgcagtgaagcttaccctggccaa
attaccaagaacatgatatgtgtaggattcatggagggaggaaaagactcctgccagggg
gattccggcggcccagtagtctgcaatgggcagctccagggcattgtttcctggggcatt
ggatgtgcgcagaaaggctatcctggggtttacactaaggtttgcaattacgtctcctgg
atcacagcaactatatctgccaactga

DBGET integrated database retrieval system