KEGG   Falco cherrug (Saker falcon): 102054877Help
Entry
102054877         CDS       T02911                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04110  Cell cycle
fch04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102054877 (RB1)
   04218 Cellular senescence
    102054877 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102054877 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102054877 (RB1)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102054877 (RB1)
Transcription factors [BR:fch03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    102054877 (RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rb_C RB_A RB_B DUF3452 DUF1955
Motif
Other DBs
NCBI-GeneID: 102054877
NCBI-ProteinID: XP_014141645
LinkDB All DBs
Position
Unknown
AA seq 853 aa AA seqDB search
DGAPAYNKKKKETWGVCIFIVAIDLDEMTFTFTELLKSISISVCTFFQFLKEVDVNMDTV
STKVDSTVSRLKKKYDVLLALYHKFERTCGLIYLEQPSSEISAELSSVLVLKNYWITFLL
AKGKVLQVEDDLVISFQLLLCVLDYFIKLSPPAMLKEPYKSAVTAVTVNGSARTPRRGQN
RSTRTSKQIDTDTKVIEVLCKEHDCNLDEVKNVYFTSFIPFLNSVGIVAANGLPEVEVIS
KQYNELYLKNKDIDARLFLDHDETLQPDVIACSQLERTPLKNNPDEELNLILPQTPVRAA
MNNIQQLIMILNSATDKPSDTLIMYFNNCTVNPKDSVLKRVESLDRIFKKKFAEAVGQGC
AEIGSQRYKLGVRLYYRVMESMLKSEEERLSVQNFSKLLNDNIFHTSLLACAVEVVMATY
GRNASQSDGTSAETDLSFPWILDVFDLKAFDFYKVIESFIRAEPSLTREMIKHLEHCEHR
IMESLAWQSGSPLFDLIKQSKEREGQTDQPEPTSTLNLPLQHNHTAADLYLSPVRSPKKK
ASGPPLSATSTPDAPPGVTPQTQKPQKSTSLSLFYKKVYLLAYLRLRTLFFRLLSEHPDL
EPLIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNVDLRFKIIVSAYKELPNTNQ
ETFKRVLIREEKYDSIIVFYNLVFMQKLKTNILQYASNRPPTLSPIPHIPRSPYQFSNSP
RRVPAGNNIYISPLKSPYKFSDGFQSPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNS
DCQLKRSAEVSAAPKPLKRLRFDIEGQDEADGSKHLPQESKFQQKLAEMTSTRTRMQKQK
LNDGNDTSASEEK
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
gacggcgccccggcttataacaaaaagaaaaaggaaacatggggagtctgtatctttatt
gtagcaattgacctggatgaaatgacattcactttcacagagcttttgaaaagtataagc
ataagtgtatgcacgttttttcagtttctgaaagaggtggatgttaacatggatactgta
agcactaaagttgatagcactgtatcaaggctgaaaaagaaatatgatgtattacttgca
ctataccacaagtttgaaaggacttgtggccttatttatttggaacaacctagtagtgag
atttcggctgaactcagttcggtattagtcctaaaaaattactggattacttttttgctg
gcaaaaggtaaagtgttgcaagtggaagatgacctggtgatttctttccagttgttgctg
tgtgtcttagattattttatcaaactgtcacctcctgctatgctcaaggaaccatacaag
tctgctgtgactgcagtgactgttaatggttcagctcgaactccaagaagaggtcagaac
aggagtacacggacttcaaagcaaattgataccgatacaaaagttattgaagtcctttgt
aaagagcatgattgcaatttagatgaggtcaaaaacgtgtatttcacaagctttattcct
ttcttgaattctgtgggtattgtagctgcaaatggactaccagaggttgaggttatctca
aaacaatataacgagctgtatctcaaaaacaaagacatagatgcaagattatttctggat
cacgatgaaactctacagcctgatgtcatagcatgctcacagttggagaggacaccacta
aaaaacaatccagatgaggaacttaatcttatacttccacagactcctgttcgagctgca
atgaataacattcaacaattgattatgattttaaactcagcaactgataaaccatcggat
actctcatcatgtacttcaataattgcacagtgaatcctaaggatagtgtcctcaaaaga
gtggaaagtcttgaccgcattttcaaaaagaaatttgctgaagcagttggacagggatgt
gctgaaattggctcacagaggtacaagcttggagtacgtctgtattacagagtaatggag
tctatgctaaagtcggaggaagagcgcctttcagtgcagaatttcagcaaacttctgaat
gataacatcttccacacatctcttctggcgtgtgctgttgaggttgtcatggcgacatat
ggtagaaatgcttcacaaagtgatggtaccagtgctgaaacagacttgtctttcccgtgg
atactcgatgtatttgatttaaaagcttttgacttctacaaggtgattgaaagctttatt
agagcggagccaagcctaacaagggaaatgataaagcatctagaacactgtgaacatcga
attatggagtcgcttgcgtggcaatctgggtcacctctgtttgatctaatcaagcagtca
aaagaacgagaaggccaaactgaccagcctgagcccacttccactcttaatctgcctctc
caacataatcacaccgcagcagacctctatctttctcctgtgagatctcctaagaagaaa
gcatctggacctcctttaagtgctacttccactccagatgctccaccaggtgtgaccccc
caaacacagaaaccacagaaatctacctccctctctctgttctacaaaaaagtgtatcta
ctggcgtatctacgactgcgtaccctgttctttcggcttctctctgaacatcctgacctg
gaacccttgatctggaccctcttccagcacacactgcagaatgagtatgagcttatgaga
gacaggcacttggaccagatcatgatgtgttccatgtatggcatatgcaaagtaaagaat
gtagatcttagatttaaaataatagtttcggcatacaaggagctccccaacacaaatcaa
gagactttcaaacgtgttcttatcagggaagaaaagtatgactccattatagtcttctac
aacttagtgtttatgcagaagctgaaaacaaacatattgcagtatgcctccaacaggcct
cccactctgtcacctatcccacacattcctcggagcccttaccagttttccaactcgcct
cggcgtgtccctgctggcaataacatctacatctcgcccttgaagagcccatacaaattc
tctgatgggtttcagtcgcccacaaagatgactccaaggtctagaattttggtgtcaatt
ggtgaatcatttgggacttctgaaaagtttcaaaaaataaaccagatggtatgcaacagt
gactgccagctaaaacgcagcgcagaagtaagtgctgctcctaagccactgaagaggctg
cgctttgatatagaaggacaagacgaagcagatggaagcaaacacctaccccaggaatcc
aagttccaacaaaagcttgcagaaatgacatctactcgaacaagaatgcaaaaacagaaa
ctgaatgatggaaatgatacctcagccagtgaagaaaagtga

DBGET integrated database retrieval system