Falco cherrug (Saker falcon): 102054961 Help Entry 102054961         CDS       T02911                                  Symbol INS Name (RefSeq) LOW QUALITY PROTEIN: insulin   KO K04526   insulin Organism fch  Falco cherrug (Saker falcon) Pathway fch04010   MAPK signaling pathway fch04068   FoxO signaling pathway fch04114   Oocyte meiosis fch04140   Autophagy - animal fch04150   mTOR signaling pathway fch04810   Regulation of actin cytoskeleton fch04910   Insulin signaling pathway fch04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:fch00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102054961 (INS)    04068 FoxO signaling pathway     102054961 (INS)    04150 mTOR signaling pathway     102054961 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102054961 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     102054961 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102054961 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102054961 (INS)    04914 Progesterone-mediated oocyte maturation     102054961 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fch04052]     102054961 (INS) Cytokines and neuropeptides [BR:fch04052]  Neuropeptides   Neuropeptides (Unclassified)    102054961 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  102054961 NCBI-ProteinID:  XP_005439170 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MAILLPTXQSSSLRANFSPSLAATSRGLTLLTMALWIRSLPLLALLTLSGPGTSHAAATQ HLCGSHLVEALYLVCGERGFFYSPKARRDVEQPLVSSPLHGEAGELPFQQEEFEKVKRGI VEQCCHNTCSLYQLENYCN NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggcgatattgctaccaacctaacagtcttcatctctcagagcaaacttctccccatct cttgctgccacttctcgaggtctcaccctgctcaccatggctctctggatccgatcgctg cctctcctggcccttctcactctttctggccccgggaccagccacgcggctgccacccag cacctctgtggctcccacttggtggaggctctctacctggtgtgtggagagaggggtttc ttctactcccccaaagcccgccgggatgttgagcagcctctagtgagcagtcccttgcac ggtgaggccggagagctgcccttccagcaggaggagtttgagaaggtgaagcgagggatc gttgagcaatgctgccacaacacgtgctccctctaccaactggaaaactactgcaactag

DBGET integrated database retrieval system