KEGG   Falco cherrug (Saker falcon): 102055022
Entry
102055022         CDS       T02911                                 

Gene name
PTPRF
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase F isoform X1
  KO
K05695  receptor-type tyrosine-protein phosphatase F [EC:3.1.3.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04514  Cell adhesion molecules
fch04520  Adherens junction
fch04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102055022 (PTPRF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102055022 (PTPRF)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102055022 (PTPRF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102055022 (PTPRF)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102055022 (PTPRF)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    102055022 (PTPRF)
SSDB
Motif
Pfam: Y_phosphatase fn3 I-set Ig_3 Pur_ac_phosph_N Ig_2 ig fn3_2 Interfer-bind PTP_tm V-set DSPc Y_phosphatase3 C2-set_2 Y_Y_Y PTPlike_phytase Ig_5 Insulin_TMD DUF3377 ICAM_N TMEM154
Other DBs
NCBI-GeneID: 102055022
NCBI-ProteinID: XP_027658538
LinkDB
Position
Unknown
AA seq 1909 aa
MVPNFCVPVLTVPAAILCCLMLPLAGADSKPTFMKAPEDQIGISGGVASFVCQATGEPKP
RITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRVHRDEAIYECTATNSVGEINTSAKL
TVLEEDHLPAGFPTIDMGPQLKVVEKARTATMLCAASGNPDPEISWFKDFLPVDTATSNG
RIKQLRSGALQIENSEESDQGKYECVATNSAGTRYSAPANLYVRDQREVRRVAPRFSIPP
SNHEVMPGGSVNLTCVAVGAPMPYVKWMAGVEELTKEDEMPVGRNVLELNNIMQSANYTC
VAISSLGMIEATAQITVKALPKPPTEPLVTETTATSVTLTWDSGNSDPISYYVIQYKPKS
LEGQFQEVDGVATTRYSIGGLSPFSEYEFRVIAVNNIGRGPPSELVEARTGEQAPSSPPL
KVQARMLSASTMLVQWEQPEEPNGQIRGYRVYYTTDPHLPLSMWQKHNTDDSHLTTVGSL
ITGTTYSIRVLAFTSVGDGPPSDIIQVKTQQGVPAQPADFQAEAESDTRILLTWLPASQE
RITKYELLYWEGEDGTQQKLEFDPTSSYAVEGLKPDTLYKFRLGARSELGVGVYTPMIEA
RTAQSTPSAPPQEVECVSTSSTTIRVSWVPPPAQSRNGVITQYSIAYQAVEGDDNTKHVV
DGIGREHSSWEIKDLEKWTEYKVWVRAHTNVGPGPESIPVHVRTDEDVPSAPPRKVEVES
VNSTAIRVSWKLPISNKQHGQIRGYQVTYVKLENNEPRGQPVIKDVMLSEAQWRAEDSVD
HETVIGGLLPETTYSVTVAAYTTKGDGARSKPKVITTTGAVPGKPTMMISTTAMNTALIQ
WHPPKEMVGELLGYRLQYRRLDEEKMNTIDFGKRDHHYTVTNLHKGATYLFRLSAKNRAG
PGEEFEKEITTAEDVPSGFPQNLRVVGLTTSTTEVAWDPPVLAERNGKIVNYTVVYRDIN
SQQDLVNITRDTSITLTNLKPDTTYDIKVRARTNKGVGPLSPSIQSRTMPVEQVFAKNFR
VNAVMKTSVLLSWEVPDSYKSAVPFKILYNSQSVEVDGHSMKKLISDLQPDTDYSFVLMN
RGSSAGGLQHLVSIRTAPDVLQSKPIATNKYIQEGKFTLTLPKVQTSVPVRWYYIVVVPA
DQSTSSPTARWRTPDEMELDQLLEAISQGSQSRRQRRQADRLKPYIAAQVDVLPETFTLG
DEKNYKGFYNKPLSQDLSYRCFVLASLEDGDTKRYAASPYSDEIVMEVASAKQQDEPEML
WVMGPVLAVILIIIIVIAILLFKSKQERKRAHSPSSKDEHSIGLKDSLLAHSSDPVEMRR
LNYQTPGMRDHPPIPVTDLADNIDRLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPK
NRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETLSDFWRMV
WEQRTATIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVTLLDTVELATYTVRTFALYKN
GSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCF
IVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPAR
NLFAHIQKLTQVPPGESVTAMELEFKLLANSKAHTSRFISANLPCNKFKNRLVNIMPYEL
TRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVML
TKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQF
QFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLER
MRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
NT seq 5730 nt   +upstreamnt  +downstreamnt
atggtgcctaacttctgtgtcccagtactcactgtgccagcagccatcctctgctgcttg
atgctgcctttagcaggagcagacagcaagccaacatttatgaaagctcccgaagatcag
attgggatttctggaggagtggcctcttttgtgtgtcaggcaacaggagagcccaaacct
cgtatcacatggatgaagaaggggaagaaagtcagttctcagcggtttgaggttattgag
tttgatgatggatcaggatcagttctacggatacagcccctgcgtgttcatcgagatgaa
gctatctatgagtgcacagcaaccaatagtgttggggagataaacacgagtgccaaatta
acagtgttagaagaagaccacctcccagctggcttcccgaccattgacatgggcccgcag
ctgaaggtggtggaaaaggcccgcacagccacaatgctctgtgctgccagcggtaaccct
gatcctgaaatctcctggttcaaggatttcctgcctgtcgacactgcaactagcaatggg
cgaatcaagcagctccgctcgggagctctacaaatagagaacagtgaggagtcagaccaa
ggcaaatacgaatgtgttgcaaccaacagcgcaggaacccgctactctgccccagctaac
ctttacgttcgagatcagcgagaagtgcggcgtgttgctcctcgattctctatccctcca
agcaaccacgaggtgatgcctggagggagcgtgaacctcacatgcgtggcagtaggtgct
ccgatgccctacgtgaagtggatggctggtgtggaggaactgaccaaagaggatgagatg
cctgtcggtaggaatgtcctggagctgaataacatcatgcagtctgccaactacacctgc
gtggccatctcctcccttggcatgattgaagccacagcccagatcactgtcaaagcactg
ccaaaacctccaacagagccattagtgactgaaacgacggctaccagcgtgaccctcacc
tgggattcaggcaactctgaccccatttcatattacgtcatccagtacaagcctaaatca
ttggagggtcagttccaggaggtggatggagtggcaacaactcgctatagcataggtggg
ctcagccccttctcggagtatgagttccgagtcatcgcagtcaataatattggcagaggt
ccccccagtgagctggtcgaggcccggacaggagagcaagctccttcaagtccacccctc
aaagtccaggcacggatgctgagcgccagcaccatgctggtccagtgggagcagccagag
gagccaaacggacagatccgagggtaccgcgtttactataccactgacccgcatctgcct
ttgagcatgtggcagaaacacaacactgatgacagccacctcaccactgtggggagcctc
atcacagggaccacatacagcatccgcgtcctggcatttacttcagtgggtgacggaccc
ccttcagacatcatccaggtcaaaacacagcagggagttcctgcccagccagctgacttc
caggcagaagcagagtctgatacacgcatcctgttgacgtggctgcctgcctctcaggaa
cgcattactaaatatgagctgctctactgggaaggggaggatggcactcagcaaaagttg
gagtttgacccaacttcctcatatgccgtggaaggtctcaaaccagacactctgtataag
ttccgcctgggtgcccgctcagagctgggggtaggagtctacacccccatgatcgaagcc
agaactgctcaatccaccccctccgccccaccccaagaagttgagtgtgtaagcaccagc
tccactaccatccgggtaagttgggtgccaccgcctgcccagagccgcaatggggtcatc
acccagtactccattgcctaccaggcagtggaaggagatgacaacaccaagcatgtggtg
gatggcattggacgggagcactccagctgggagatcaaggacctggagaaatggaccgag
tacaaggtgtgggtaagggctcacaccaatgtgggtccaggaccggagagcatccccgtg
cacgtgcgcactgacgaggatgtgcccagtgccccaccaagaaaggtggaggtagagtcc
gtgaattcgacggccatccgggtgagctggaagctgcccatctctaacaagcagcacggg
cagatccgcgggtaccaggttacgtacgtgaaactggaaaacaacgagcccagaggacag
ccagtgatcaaggacgtcatgctgtcggaagcacagtggagagctgaggactccgtcgac
catgagacagtcattggaggcctgctgccagaaaccacctactctgtcacagtcgctgcc
tacaccaccaaaggagatggtgcccgcagcaagccaaaagtcatcaccaccacaggggca
gtcccggggaagcccaccatgatgattagcacgacagccatgaacacagccctcatccag
tggcacccacccaaggagatggtaggggagctgctgggttaccggctgcagtacagacgt
cttgatgaggaaaagatgaacacgatagacttcgggaagagagaccatcactacactgtg
accaacctgcacaagggggccacatacctcttcagactgtctgccaagaacagagctggc
ccaggagaggagtttgagaaggagatcactactgcggaagatgtgccaagtggcttcccg
cagaacctgcgtgtggtgggtctcaccacttccaccacagaagttgcatgggacccccca
gtcttggcagaaagaaacggcaagatcgtcaactacactgtggtatacagggacataaat
agccagcaggacctcgttaacatcaccagggacacaagtatcactttgacgaatctgaag
ccagataccacttacgacatcaaagtgagggcccgcaccaataagggggttgggccgctc
agccccagcatccagtcccggaccatgcctgtggagcaagtgtttgctaagaacttccgc
gtcaatgccgtcatgaaaacgtctgtgttgctgagctgggaagtgcctgactcctataaa
tctgcagtgccttttaagattctgtacaatagccagagtgtggaggtggatggccactcg
atgaagaaactcataagtgacctccagccagacacggactattcttttgtgctaatgaac
cgtggcagcagtgctggggggctccagcaccttgtctcgatccgcaccgctcctgacgtc
ttgcaaagcaaacccatcgccacaaacaagtacatacaggaaggaaaattcacactcacc
cttcccaaagtccagacctctgtgccggttaggtggtactacatcgtggttgtgccagca
gatcagagcaccagcagcccaactgctcgatggcggacacctgatgagatggagctggac
cagctgctggaggccataagccaagggagtcagagcaggcgccagcgacgccaagcagac
agactcaagccctacattgctgctcaagtggacgtgctgcccgagactttcaccctgggg
gacgagaagaactacaaaggtttctacaacaagcccctgtctcaagacttgagctatcgt
tgcttcgtgctggcctcactggaggatggagacacgaagagatatgcagccagcccctac
tcggatgagatcgtgatggaagtggcttcagcaaaacagcaggatgaaccagagatgctg
tgggtgatgggacctgtcctggccgtgatattaatcatcatcattgtcattgctatactc
cttttcaaaagtaagcaagaaaggaaaagggcacactccccgtcttccaaggatgagcac
tccattggcctgaaggactcgcttttggcccactcctctgacccagttgagatgaggcgg
ctcaactaccagactccaggcatgcgcgaccacccccccatccctgtgacagaccttgcc
gacaacatcgacaggctgaaggccaacgacgggctgaagttctctcaggagtacgagtcc
attgatcccgggcagcagttcacctgggagaactccaacctggaagtgaataaaccgaaa
aaccgctatgcaaatgtgatcgcctatgaccattcacgagtcatcctgacttccattgat
ggagtcccaggcagtgattacatcaatgccaattacattgatgggtatcggaagcagaac
gcctacatcgccacgcagggacctctgccagaaaccctcagcgacttctggaggatggtg
tgggaacagagaacagcaactatagtcatgatgaccaggctggaggagaaatccagggta
aagtgtgaccagtactggccgagccggggtactgaaacctatgggatgatccaggtgact
ctgctggacacagtcgagctggcgacctacaccgtccgcacctttgcactgtacaagaac
ggctccagtgagaagcgagagctgagacagttccagttcatggcttggcctgatcacggg
gtaccagaatacccgaccccaatcctagctttcctgcgacgggtcaaggcctgtaaccca
ccagatgctgggcccatggttgtccattgcagtgctggcgtgggccgaactggttgcttc
attgtcattgatgccatgctggagcggatgaagcatgagaagactgtggacatctatggc
cacgtgacgtgcatgcgctctcagcgcaactacatggtgcagacagaggaccagtatatc
ttcatccatgaggccttgctggaggcagccacatgtggcaataccgaggtgcctgcacgc
aacctctttgctcacatccagaagctgacccaggtgccaccaggcgagagcgttactgca
atggagctggagttcaagctgctggccaactctaaagcacatacctcacgtttcatcagt
gccaacctcccgtgcaacaaattcaagaaccgcctcgtgaacatcatgccatatgagctg
acaagagtctgtctgcagcccatccggggtgtcgagggctccgattatatcaacgccagc
ttcatagatgggtacaggcagcagaaggcctacatcgccacgcagggaccactggccgag
accacggaggatttctggcggatgctctgggagcacaactccaccatcgtggtgatgttg
acaaagctacgcgagatgggccgggagaagtgccatcagtactggcccgcagagcgctct
gcccggtaccagtacttcgtggtggaccccatggcagagtacaacatgccgcagtacatt
ctccgggagttcaaggtgacagatgccagggacggccagtcacggaccatccgccagttc
cagttcacagactggcctgagcagggagtgccaaagacgggagagggcttcatcgacttc
atcgggcaggtgcacaagaccaaggagcagttcgggcaggatgggcccatcacggtgcac
tgcagcgctggggttgggcgcacaggcgtgttcatcacactcagcatcgtgctggagagg
atgcgctacgagggggtggtggacatgttccagacggtgaagaccttgaggacgcagcgg
ccagccatggtgcagacagaggaccagtaccagctgtgctacagagcggcactggagtat
ctcggcagcttcgaccactatgcaacgtaa

DBGET integrated database retrieval system