KEGG   Falco cherrug (Saker falcon): 102055063Help
Entry
102055063         CDS       T02911                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00010  Glycolysis / Gluconeogenesis
fch00051  Fructose and mannose metabolism
fch00052  Galactose metabolism
fch00500  Starch and sucrose metabolism
fch00520  Amino sugar and nucleotide sugar metabolism
fch00524  Neomycin, kanamycin and gentamicin biosynthesis
fch01100  Metabolic pathways
fch01200  Carbon metabolism
fch04910  Insulin signaling pathway
Module
fch_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fch_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102055063 (HK1)
   00051 Fructose and mannose metabolism
    102055063 (HK1)
   00052 Galactose metabolism
    102055063 (HK1)
   00500 Starch and sucrose metabolism
    102055063 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102055063 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102055063 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102055063 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102055063 (HK1)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102055063 (HK1)
Membrane trafficking [BR:fch04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102055063 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102055063
NCBI-ProteinID: XP_005433496
LinkDB All DBs
Position
Un
AA seq 889 aa AA seqDB search
MRLSDETLIDVMARFRREMKNGLSRDFNPTAAVKMLPTFVRSIPDGSEKGDFIALDLGGS
YFRILRVKVSHEKKQTVQMESEIYNTPEDIMHGSGTRLFDHVAECLGDFMEKQQIKDKKL
PVGFTFSFPCRQSKLDEGILITWTKRFKASGVEGADVVKLLNRAIKKRGDYDADIMAVVN
DTVGTMMTCGFDDQRCEVGLIIGTGTNACYMEEMRHIDLVEGDEGRMCINTEWGAFGDDG
SLEDIRTEFDREIDRGSLNPGKQLFEKMVSGLYMGELVRLILVKMAKEGLLFEGRITPEL
LTKGKFETKHVSAIEKSKEGLNKAKEILTRLGVEPSHEDCIAVQHVCTIVSFRSANLVAS
TLGAILNQLRDNKGVGRLRTTVGVDGSLYKMHPQYARRLHKTTRRLVPDSEVRFLLSESG
SGKGAAMVTAVAYRLSEQHRLIDETLAEFKLTHEQLLQVKRRMRAEMEAGLKKKTHETAK
VKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQ
GTGEELFDHIVTCISDFLDYMGIKGARLPLGFTFSFPCKQTSLDAGILLNWTKGFKATDC
EGEDVVYLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYME
EMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDDIRTIYDKAVDDYSLNAGKQRYEKMISGM
YLGEIVRNILIDFTKRGFLFRGQISETLKTRHIFETKFLSQIESDRLALLQVRAILQQLG
LNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAAVVDKIRENRGLEHLEITVGVDGTLYKLH
PHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKGAALITAVGCRLRDAEQN
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcggctctctgacgaaacgctgatagacgttatggctcgcttcaggagagagatgaaa
aatggcctctccagagattttaatccaacggctgcagtgaagatgcttcctacgtttgtg
aggtccattcctgatggttcagagaaaggagatttcattgcactggatctcggtggttct
tatttccgaattctgcgggtgaaggtatcgcatgaaaaaaagcagacggtacaaatggaa
agtgaaatttataatacacctgaagatatcatgcatggcagcggaacacggctttttgat
catgttgctgaatgcttgggagacttcatggagaaacaacaaatcaaggacaagaaatta
ccagttgggtttacattttctttcccttgtcgacaatctaagctagatgagggtattctg
ataacctggacgaagcgtttcaaagcaagcggagtggagggagcagatgtcgtgaagctg
cttaacagggccatcaagaaacgtggggactatgatgcagatatcatggctgttgtgaat
gacaccgtcgggacgatgatgacctgtggttttgatgaccagcgttgtgaagttggcttg
atcattggcactggcaccaacgcctgttacatggaggagatgcggcacattgacctggtg
gaaggggacgagggcaggatgtgcattaacacggagtggggagcttttggagatgatggc
tcgctagaagacatcaggaccgagtttgatcgagagatcgaccgtggatcccttaatcct
gggaagcagctgtttgagaagatggtcagtgggctgtacatgggggagctggtaaggctt
atcctggtgaagatggccaaggaggggctgctctttgaggggagaatcacccctgagctt
ctcaccaaagggaagtttgagacaaagcacgtttctgccatagaaaagagcaaagaaggt
ttgaacaaagccaaagaaattttaacccgcctgggggtggagccgtcccacgaggactgc
attgccgtccagcacgtctgcaccatcgtgtccttccgctcggccaatctggttgcctct
acgctgggtgccatcctcaaccagctgcgggacaacaaaggggtcggccgcctccggacc
accgtgggggtcgacggctccctctacaagatgcatccacagtatgcccggcgcttgcat
aaaaccacccggcgcttggtgccggactcggaagtgcggttcctgctgtcggagagcggc
agtgggaagggagcagcgatggtgacagcggtggcgtaccggctgtcagaacagcaccgg
ctcatcgacgagacgctggctgagttcaagctcacccatgagcagctgctgcaggtgaag
aggaggatgagggcggagatggaagcgggactgaagaagaagactcatgagactgccaaa
gtcaaaatgctgcccaccttcgtccgcagcacaccggatgggacagagaacggagatttt
ctggcacttgaccttggaggaacgaactttagagttttgctggtgaaaatccgcagcggt
aaaaggagaacagttgagatgcacaacaagatctatgccattcctatagaggtgatgcag
ggaacaggagaagagctgtttgatcatattgttacctgcatttctgacttcctggattat
atggggataaaaggcgcacgtctccctcttggcttcacattttccttcccttgcaagcag
accagtctggatgctggtatccttctcaattggacaaaaggcttcaaagctacagactgc
gagggagaagatgtggtgtatttgcttagagaaggaattaaaagaagagaggagtttgac
ttggatgtggtggctgtggtgaatgatacggtgggcacaatgatgacttgtgcttacgaa
gacccaaactgtgaaatcggactcattgtgggaactggcagcaatgcctgttacatggag
gagatgagaaacatagagatggtggacggtgagcaaggacggatgtgcgtgaacacagag
tggggagcgttcggggataatggatgcctggatgatatcaggacaatatatgacaaagca
gttgatgactattcactaaatgctggaaagcaaaggtatgagaaaatgatcagcgggatg
tacctgggggaaatagtccgcaatattttgattgacttcaccaagcgggggttcctgttc
agaggccagatttcagagacactgaagaccagacatatctttgaaaccaagttcctttct
cagattgagagtgacaggttagccttgctgcaggtgcgagccatcctccagcagctgggg
ctcaacagcacctgtgatgacagtatcattgtcaagactgtgtgcggagcggtgtcaagg
cgagcagctcagttgtgcggtgccggaatggctgcagttgtagataaaattagggagaac
agaggattagagcacctggagataacggttggtgtggatgggactctgtacaaactacat
ccacacttttcaaggatcatgcaccaaacagtcaaagatctggcacccaactgcgacgtg
accttcctgctgtcagaggacggcagcgggaaaggggcagcgctcatcacagctgtggga
tgcaggcttcgcgatgccgagcagaactga

DBGET integrated database retrieval system