KEGG   Falco cherrug (Saker falcon): 102055294
Entry
102055294         CDS       T02911                                 

Definition
(RefSeq) B-cadherin-like
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04371  Apelin signaling pathway
fch04514  Cell adhesion molecules
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102055294
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102055294
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102055294
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fch03036]
    102055294
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fch04515]
    102055294
   04090 CD molecules [BR:fch04090]
    102055294
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102055294
Cell adhesion molecules [BR:fch04515]
 Cadherins
  Major cadherins
   102055294
CD molecules [BR:fch04090]
 Proteins
  102055294
SSDB
Motif
Pfam: Cadherin Transthyretin
Other DBs
NCBI-GeneID: 102055294
NCBI-ProteinID: XP_027657876
LinkDB
Position
Unknown
AA seq 504 aa
MSPCTFSLLVLLLDMLVFPEHGHGLQRQKRDWVIPPINCPENERGPFPKKLVQIKSNKDK
ETTVFYSITGQGADTPPVGVFTIERETGWLEVTKPLDREEIDKYVLFSHAVSANGQPVED
PMEIIITVTDQNDNRPIFTQAVFNGTVLEGAEPGTHVLQVLATDQDDMVNSNNGIVLYSI
LRQTPGWPQPHMFAINPSTGAIFVTAAGLVAQMVPEYTLEVQAADMDGYGLQATATVLIK
VQMVPEYTLEVQAADMDGYGLQATATVLIKVQVRCPRCLQRQCPGGEWQLGCGQGPGTDG
TEPHDTGRTCVTALGHSRVLGTEGSAGTALAAGRWYTSTVSKGPSGEGLGARLWHGQPRH
REAGRQAALPAHIPASLTPLPQAKDPPEMANGPLTTHVLNTATGLPAAGLAIRLSQLQEP
GQQWTELVQRWTDADGRCLPLLAVGQAEAGTYKLRFETAAYWQGLGHASFYPFVEVVFTI
TDASQKLHIPLLISPYSYTTYRGS
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtcaccctgcaccttctccctcctcgttctcctgctggacatgctggtcttccctgag
catggccatggcctccagcggcagaagagggactgggtcatcccccccatcaactgcccc
gagaacgagcggggacccttccccaagaagctggtgcagatcaaatccaacaaggacaag
gagaccacagttttctacagcatcacggggcagggggcggacaccccccccgtgggtgtc
ttcaccattgagcgggagacggggtggctggaggtgacgaagccgctggaccgggaggag
atcgataaatacgtcctcttctcccacgccgtgtcggccaacgggcagcctgtggaggac
cccatggagatcatcatcaccgtcacagaccagaatgacaaccggcccatcttcacccag
gcagttttcaatggcaccgtgctggagggggctgagccaggcacccatgtgctgcaggtg
ctggccacggaccaggacgacatggtgaactccaacaatggtattgtgctctactccatc
ctgcgccagacgccgggctggccccagccccacatgtttgccatcaacccgagcactggg
gcaatcttcgtgactgctgcagggctagtagcacagatggtccctgaatacaccctggag
gtccaggcggctgacatggacgggtacgggctgcaggccactgccaccgtcctcattaaa
gtgcagatggtccctgaatacaccctggaggtccaggcggctgacatggacgggtacggg
ctgcaggccactgccaccgtcctcattaaagtgcaggtgaggtgcccacgctgcctgcag
cggcagtgcccggggggggagtggcagctgggctgtgggcagggccctggcactgacgga
actgagccccatgacacgggaaggacatgtgtcacggccctgggacacagcagggtgctg
gggacagagggttctgctgggacagccctggctgcagggaggtggtacaccagtactgtg
agcaagggtccctctggagaggggctgggggctcggctgtggcacgggcagccgcggcac
agagaagcggggaggcaggcagcgctgccagcacacatcccagcctcgcttactcctctg
ccccaggctaaagacccccccgagatggcgaatggccccctgaccacccacgtgctgaac
acggcgacggggctgccggccgctggcctggctatccggctgtcccagctgcaggagccg
gggcagcagtggacggagctggtgcagaggtggacagatgcggacgggcgctgcctgccc
ctcctggctgtgggacaggccgaggccggcacctacaagctgcgctttgagacggcagcg
tactggcagggcctggggcatgccagcttctacccctttgtggaggttgtgttcaccatc
accgacgcctcccagaagctgcatatcccactgctgatcagcccctactcctacacaacg
taccggggcagttag

KEGG   Falco cherrug (Saker falcon): 102055639
Entry
102055639         CDS       T02911                                 

Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04371  Apelin signaling pathway
fch04514  Cell adhesion molecules
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102055639
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102055639
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102055639
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fch03036]
    102055639
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fch04515]
    102055639
   04090 CD molecules [BR:fch04090]
    102055639
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102055639
Cell adhesion molecules [BR:fch04515]
 Cadherins
  Major cadherins
   102055639
CD molecules [BR:fch04090]
 Proteins
  102055639
SSDB
Motif
Pfam: GAS Cadherin Cadherin_C Cadherin_pro Big_9 DUF3573
Other DBs
NCBI-GeneID: 102055639
NCBI-ProteinID: XP_027658578
LinkDB
Position
Unknown
AA seq 1216 aa
MSKEQLQKHVVRLREELDREREERNYYQLERDKIHTFWEITRQQLEEKRAELRNKDREME
EAEERHQVEIKVYKQKVKHLLYEHQENLTEVKVERTLSMKQAQNDHWAQEIELRKDMGSL
RVELKEQELAHEVVVKNLCLKQKEEITRLCNVFEGQVKEIEAKYTKKMQMLRDELELRRK
TEIHNVEERKNNHISELMRNHEKAFSDIKNYYSDTTTKNLAFISLLKEQMEEVKKRENHL
EKENTNMLLQNNKQKESLRQVQEQVSELQKKLTHYDKDKAALMNTKALLKVTQKELKDLR
WEHEVLEQRFVKVQAERDELYQKFTKAINEVQQKTGFKNLLLERKLKGLLSVLEKKEVEL
SEVLAASSLDPSAISLVSHKLEDMLNSKNSTIKDLQFQLARACKAHNDMLQTFEAKLTAF
GIPLDNLGFKPLVSPVAGQVLGQVSFVNCGEQQRAMYLSDDTHFRVSRDGVISATRPLQL
QQQEISFSVYAWDVLGKKHSTRVTLRRWWHHHLHQHQDAAPDVLIFPKHGHGLQRQKRDW
VIPPINCPENERGPFPKKLVQCPSQLFSHAVSANGQPVEDPMEIIITVTDQNDNRPIFTK
QVFVGYIEENAKPGTSVMTVNATDADDGVNVNNGIINYSILSEEPKSAQRMFTIDPEKGI
ISVIGTGLDRETTPNYTLIIQAADQEGSGLTNTATAIVEVTDANDNPPIFNPTSYEGTVN
ENEVGVVVARLHVMDGDMQGSPAWQAVYRIKSGDQDGDFSITTDPKTNDGILKTAKGLDY
ETRSRYNLVVTVENAVPFTVPLPLSTASVLVLVGDVNEAPVFVPPVKRVEVMEDLPLGHQ
VTSYTAQDPDKDQRQKITYRMGSDPAGWLAIDPENGIVTAAQPLDRESMHAINSTYKAIV
LAVDSGSPDATGTGTLLLLLQDVNDNGPMPEPRIFDICNRQPEEQTLNIVDKDLPPNTYP
FQAGLEHGSGANWTVRVIEQDLLVLKLVKQLEPGEYSIFLKLTDGQGKVQVTPVKAQVCD
CEGPAKNCERRAYIASGVGIPTILGILGGILVLLILLLLLLLFARRRRVVKEPLLPPEDD
MRDNVYHYDEEGGGEEDQDYDLSQLHRGLDARPEVIRNDVAPPLMTAPQYRPRPANPDEI
GNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEATSLSSLNSSASDRDQDYDYLNDWGS
RFRKLADLYGGGEDDD
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgagcaaggagcagctgcagaagcatgttgtgcgcctccgggaggagctggaccgggaa
cgggaagagcgcaactattaccagctagagcgtgacaagattcacaccttctgggagatc
acccgccagcagctggaggagaagcgagcagagctgcggaacaaggaccgggaaatggag
gaggcagaggagcggcatcaagtggagatcaaggtttacaagcagaaggtgaagcacttg
ttgtacgaacaccaggaaaacctcaccgaggtgaaggtggagcgcactctgtccatgaag
caggcccagaatgatcactgggcccaggaaatagagctgcggaaagacatgggctccttg
agagtggagctgaaggagcaggagctggcacatgaggtggtggtgaagaacctgtgtctg
aaacaaaaggaggagatcacccggctgtgcaacgtctttgagggacaagtgaaagagatt
gaggccaagtacaccaagaagatgcaaatgctgcgggatgagcttgaattgcggaggaag
actgagatccacaacgtggaggagaggaagaacaaccacatcagcgagctgatgaggaac
catgagaaagccttcagtgacatcaagaactactacagtgataccaccaccaaaaacctg
gccttcatcagcttgctgaaggagcagatggaggaggtgaagaagagagagaatcacttg
gaaaaggagaatacaaacatgctgctccagaacaacaagcagaaggagtccctacggcag
gtccaggaacaggtgtctgagctgcagaagaagttgacccactatgacaaggacaaggca
gccctgatgaacacaaaagcccttctgaaagtcacccagaaggaactgaaggatcttcgg
tgggaacacgaagtactggagcagaggtttgttaaggtgcaggcggagcgagatgagctc
taccagaagttcaccaaagccattaacgaagtgcagcagaaaacagggttcaagaacctg
ctcctggagcgcaagctgaaaggactgctcagcgtcctggagaaaaaggaggtggagctc
agcgaggtccttgcagcctccagcctcgacccaagcgcaatctccttggtctcgcacaag
ctggaggacatgctcaattccaagaactccaccatcaaggacctgcagttccagctggcc
cgagcctgtaaggcacacaatgacatgctgcagacgtttgaggcaaagctgacagccttt
ggcatccccctggacaacctgggcttcaagcccctggtgagccccgtggcggggcaggtg
ctggggcaggtgagctttgtgaactgtggtgagcagcagcgtgccatgtacctctcggat
gacacacacttcagggtgagcagggatggtgtcatttctgcaacccggcccctgcagctc
cagcagcaggagatcagcttctctgtctacgcatgggacgtcttgggcaagaagcattcg
accagggtgaccctgcgcaggtggtggcatcatcacctccaccagcaccaggacgcagcg
cctgacgtgctgatcttccctaagcacggccatggcctccagcggcagaagagggactgg
gtcatcccccccatcaactgccccgagaatgagcggggacccttccccaagaagctggtg
cagtgcccctcgcagctcttctcccacgccgtgtcggccaacgggcagcctgtggaggac
cccatggagatcatcatcaccgtcacagaccagaatgacaaccggcccatcttcaccaag
caagtctttgttggctatattgaggagaacgcaaagccgggcacatctgtgatgaccgtg
aacgccacagatgcagatgatggggtcaatgtgaacaacggcatcatcaactactccatc
ctcagcgaggagcccaagagtgcgcaacggatgttcaccattgacccggagaagggcatc
atcagtgtcatcggcaccgggctggaccgagagaccactcccaactacacactaatcatc
caggctgcggaccaggagggcagtggcctgaccaacactgccaccgccatcgtggaagtc
accgacgcaaacgacaaccctcccatcttcaaccccacctcgtatgaggggacggtgaat
gaaaatgaggtgggggtggtagtggcccggctgcacgtgatggacggggacatgcagggc
tcccctgcctggcaagctgtctaccgcatcaagagcggagaccaggatggtgacttcagc
atcaccaccgaccccaaaaccaacgatggcatcctgaaaaccgccaagggcctggattac
gagaccagaagccggtataacctcgtggtgacagtggagaatgccgtccccttcaccgtg
cccctgccgctctccacagccagtgtcctggtgttggttggagatgtgaatgaagcccct
gttttcgtgcccccagttaagagggtggaggtgatggaggatctgccactggggcaccag
gtcacctcctacactgcccaggacccggacaaggatcagaggcagaaaatcacgtaccgc
atgggcagtgaccccgcggggtggctggccatcgaccctgagaacggcatcgtcacggca
gcccagccgctggaccgggagtcaatgcacgccatcaacagcacctacaaggccattgtc
ctggcggtggacagtgggtcgccggatgccactggcacagggacgctgctccttctcctc
caggatgtgaacgacaacgggcccatgccagagccccggatctttgacatctgcaaccgg
cagcctgaggagcagacgctgaacattgtcgacaaggacctgccccccaacacctacccc
ttccaagcagggctggagcatggctctggtgccaattggactgtcagggtgattgaacaa
gacctgctggtgctgaagctggtgaagcagctggagccgggggagtacagcatcttcctg
aagctgaccgatggccagggcaaggtgcaggtgacgccagtcaaagcccaggtgtgcgac
tgtgaagggccagccaaaaactgtgagcggcgagcgtacattgctagtggcgtgggcatc
cccaccatcctgggcatcctgggtggcatcctggtgctgctgatcctgctgctgctgctg
ctgctcttcgccaggcgcaggagggtggtgaaggagccactgctcccacctgaggatgac
atgcgggacaacgtctaccactacgacgaggagggtggtggtgaggaggaccaggactat
gacctgagccagctgcaccggggcctggatgcccgccccgaggtgatccgcaatgatgtg
gcccctccactgatgactgccccccagtaccggccccggcctgccaatcctgacgagatt
gggaatttcatcgatgagaacctgaaggcggcagacacggaccccacggcccccccctac
gactccctgctggtgtttgactacgagggcagcggctcagaggccacctcgctcagctcc
ctcaactcctctgcctccgaccgcgaccaggactacgactacctcaacgactggggcagc
cgcttcaggaagctggcagacctctacggcggcggggaggacgacgactag

DBGET integrated database retrieval system