KEGG   Falco cherrug (Saker falcon): 102055369
Entry
102055369         CDS       T02911                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04020  Calcium signaling pathway
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102055369 (FGFR1)
   04020 Calcium signaling pathway
    102055369 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102055369 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102055369 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102055369 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fch04090]
    102055369 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:fch00536]
    102055369 (FGFR1)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102055369 (FGFR1)
Protein kinases [BR:fch01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   102055369 (FGFR1)
CD molecules [BR:fch04090]
 Proteins
  102055369 (FGFR1)
Glycosaminoglycan binding proteins [BR:fch00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102055369 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 FGFR3_TM V-set Ig_5 Ig_4 C2-set_2 Pkinase_fungal DUF2890 DUF1615
Other DBs
NCBI-GeneID: 102055369
NCBI-ProteinID: XP_027659551
LinkDB
Position
Unknown
AA seq 822 aa
MFTWRCLILWAVLVTATLSAARPAPTLPDQVLPKAKIEVESYSAHPGDLLQLRCRLRDDV
QSINWVRDGVQLAENNRTRITGEEVEVRDAVPEDSGLYACMTNSPSGSETTYFSVNVSDA
LPSAEDDDDEDDSSSEEKEADNTKPNQAIAPYWTYPEKMEKKLHAVPAAKTVKFKCPSSG
TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENKYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFVCKVYSDPQPHIQWLKHIEVNGSKIGP
DNLPYVQILKHSGINSSDAEVLTLYNVTEAESGEYVCKVSNYIGEANQSAWLTVTRPLAK
AIEDTPAMMTSPLYLEIIIYCIGAFLISCMVVIIIVYKMKNTTKKTDFNSQLAVHKLAKS
IPLRRQVTVSADSSSSMNSGVMLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLIL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGMEYCYNPTRVPEEQLSFKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVAMTSNQEYLDLSMPLDQYSPGF
PDTRSSTCSSGEDSVFSHDPLPDEPCLPKFPPQHTNGGLKRH
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtttacctggcggtgcctcatcctttgggctgtgctggtcacagccacgctctcagct
gccaggccggcccccaccctgcccgaccaagttctgcccaaagcaaaaatcgaagtggag
tcctactcggcccaccccggtgacctcctccagctgcgctgccggctgagggatgacgtc
cagagcatcaactgggtgcgcgacggcgtccagctggccgagaacaaccgaacgcgcatt
accggggaggaggtagaggtcagggacgcggtgcctgaggactcagggctctatgcctgc
atgaccaacagcccctcgggaagtgagaccacctacttctccgtgaacgtctcagacgcg
ctcccctctgcggaggatgatgatgatgaagatgattcctcttcggaggagaaggaggcg
gataacaccaagccaaaccaggctatcgctccctactggacctatcccgagaagatggag
aagaagctccacgctgttcctgccgccaaaacggtgaaattcaagtgtccgtcgagtggg
acgcccaaccccacgctgcgctggctgaagaatggcaaggagttcaaacctgaccaccgc
atcggggggtacaaggtccgctacgcgacctggagcatcatcatggactcggtggtgcca
tccgataaaggcaactacacgtgcatcgtggagaacaagtacgggagcatcaaccacacc
taccagctggatgtcgtggagcggtccccacaccggcccatcctgcaggcagggctgcct
gccaacaagacggtggccctgggcagcaacgtggagtttgtctgcaaggtctacagtgac
ccccagccccacatccagtggctgaagcacattgaggtgaacggcagcaagatcggcccc
gacaacctgccctacgtgcagatcctgaagcactcggggattaatagctctgatgcggag
gtgctgaccctgtataatgtgacagaggcggagagcggggagtatgtttgtaaggtttcc
aattatattggcgaggccaaccagtctgcgtggctcactgtcaccagacctctggcgaaa
gccattgaagacaccccagccatgatgacatcccccctctacctggaaatcatcatttac
tgcattggagccttcctcatctcctgcatggtggtgatcatcatcgtctacaagatgaag
aacaccaccaagaagacagacttcaacagccagctggccgtgcacaagctggccaagagc
atccccctgcgcagacaggtaacagtgtcggccgactccagctcctccatgaactcgggc
gtgatgctggtccggccctcgcggctctcctccagcggcacccccatgctggccggcgtc
tccgaatacgagctccctgaggacccgcgctgggagctgccccgggacaggctgatcctg
ggcaagcccctgggagaagggtgctttgggcaggtggtgctggcagaagcaattggcctc
gacaaggacaagccaaaccgcgtgaccaaggtggcagtgaagatgctcaaatccgacgcc
acggagaaggacttgtccgacctcatctctgagatggagatgatgaagatgatcggcaag
cacaagaacatcatcaacctgctgggagcctgcacgcaggacggacccctctatgtgatc
gtggaatacgcaagcaagggcaacttgcgagaatacctgcaagcccggcggccccccggc
atggagtactgctacaaccccacccgtgtccccgaggagcagctctccttcaaggacctg
gtctcctgcgcctaccaggtggcccggggcatggagtacctggcctccaagaagtgcatc
cacagggacctggcggccaggaatgtcctggtgactgaggataatgtgatgaagatcgct
gacttcggtctggcccgcgacatccaccacatagattactacaagaagacaacgaatggt
cgcttgccagtgaagtggatggccccagaggctctgttcgaccgaatatacactcatcag
agcgacgtgtggtccttcggcgtgctgctgtgggagatcttcacactgggcggctcaccc
taccccggcgtgccggtcgaggagctcttcaagctgctgaaggaagggcacaggatggac
aaacccagcaactgcaccaacgagctgtacatgatgatgcgggactgctggcacgccgtt
ccctcccagagacccaccttcaagcagctggtggaagacctggataggatcgtggccatg
acctccaaccaggagtacctggacctctcgatgccgctggatcagtattctcccggcttc
ccagacacccgcagctccacctgctcctcgggggaggactctgtgttttctcacgaccct
cttccagacgagccgtgccttcccaagttcccccctcagcacaccaacggcggactgaag
cgacactga

DBGET integrated database retrieval system