KEGG   Falco cherrug (Saker falcon): 102055390
Entry
102055390         CDS       T02911                                 

Gene name
PTPN1
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 1
  KO
K05696  tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102055390 (PTPN1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102055390 (PTPN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102055390 (PTPN1)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102055390 (PTPN1)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    102055390 (PTPN1)
SSDB
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 102055390
NCBI-ProteinID: XP_005444983
LinkDB
Position
Unknown
AA seq 443 aa
MLQIERRLPLPYQIRIYAFINETLQKKIVDIRHEASDFPCKVAKHPRNKNRNRYRDVSPF
DHSRIKLNQGDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNR
VMEKGSVKCAQYWPRKEEKEMFFEDTNLKLTLVSEDIKSYYTVRQLELENLTTQETREIL
HFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEHGPVVVHCSAGIGRSGTFCLVDTCL
LLMDKRKDPSSVDVKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAKFIMGDASVQEQWK
ELSNEDLDPPPEHTPPPPRPPKRTSEMHNGRMHEHTEFFPKHQVVEEEIRCSVSTVEEMV
PDGRAHSSVPLVTDSTSQDTEIRRRTVGENLRLSPHKEESMKSENSEEDDENMMTTWKPF
LVNICMFTFLTAGAYLCYRVCFH
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgctccagatagagaggagattgcctttaccttatcaaataagaatatatgcctttata
aatgaaacattacagaaaaaaatagtggacatcaggcacgaagccagtgattttccatgt
aaagtggccaaacatcctagaaacaaaaatagaaataggtacagagatgtcagccccttt
gatcacagtcgaattaagctaaaccaaggtgacaatgactatatcaatgctagtttgata
aaaatggaagaggcccaaaggagctacatccttacccagggacctttgccaaatacttgt
ggtcacttctgggagatggtttgggaacagaaaagtcgtggtgttgtcatgttgaaccga
gtgatggaaaagggatctgtaaagtgtgcacagtactggccacggaaggaggagaaagaa
atgttttttgaagatacaaatttgaaactaacattggtatctgaagatataaaatcatat
tacacagtacgacagctggaattggaaaaccttacaacacaggaaactagagagattctg
cactttcattatacgacgtggcctgactttggcgtcccggagtcacctgcttcgttcctc
aatttcctgttcaaagtgagagagtccggctcgcttaaccctgagcacgggcccgtcgtg
gtgcactgcagcgcaggaatcgggagatcgggaactttttgtttggttgatacatgtctt
ctactgatggacaaacggaaagatccttcttctgtggacgtgaaacaggttctcctagaa
atgaggaagtaccggatgggactcatacagacagcagaccagctccgtttctcctactta
gctgttattgaaggggcaaaattcattatgggagacgcgtcagtgcaagagcagtggaaa
gagctctccaatgaggacctggacccaccacctgaacacaccccaccgcctcccagaccg
ccaaagcgaacctcagaaatgcataatggaaggatgcacgaacacacggaattctttcct
aaacatcaagtagtagaggaagagattagatgttcggtcagcactgtggaagagatggtt
ccagatggcagagctcattcatctgtgccactggttacagacagcactagtcaagacact
gaaattcggaggagaactgttggtgaaaacctgcgtctctcgccccacaaagaagagtcg
atgaagtctgaaaactccgaagaggatgatgagaacatgatgacaacttggaagccattt
ctagtgaatatttgcatgttcactttcctcacagccggagcttatctctgttacagggtg
tgttttcattga

DBGET integrated database retrieval system