KEGG   Falco cherrug (Saker falcon): 102055425
Entry
102055425         CDS       T02911                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04144  Endocytosis
fch04370  VEGF signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04530  Tight junction
fch04810  Regulation of actin cytoskeleton
fch04912  GnRH signaling pathway
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102055425 (CDC42)
   04370 VEGF signaling pathway
    102055425 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102055425 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102055425 (CDC42)
   04520 Adherens junction
    102055425 (CDC42)
   04530 Tight junction
    102055425 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102055425 (CDC42)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102055425 (CDC42)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102055425 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102055425 (CDC42)
   03036 Chromosome and associated proteins [BR:fch03036]
    102055425 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102055425 (CDC42)
   04031 GTP-binding proteins [BR:fch04031]
    102055425 (CDC42)
Membrane trafficking [BR:fch04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102055425 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    102055425 (CDC42)
  Macropinocytosis
   Ras GTPases
    102055425 (CDC42)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102055425 (CDC42)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102055425 (CDC42)
  Exosomal proteins of breast milk
   102055425 (CDC42)
GTP-binding proteins [BR:fch04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102055425 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 102055425
NCBI-ProteinID: XP_005437832
LinkDB
Position
Unknown
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKTRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacgatcaagtgcgtagtcgtgggtgatggtgctgtcggtaaaacctgtctctta
atttcttacacaacaaataaattcccatcggaatatgtaccaacggttttcgataactat
gctgtaacagtgatgattggaggagagccttacaccctaggcctctttgatactgcaggt
caggaagactatgatagattacgacccctcagctatccacagacagatgtatttctggtc
tgtttttcagtggtgtctccttcttcatttgaaaatgtgaaagaaaagtgggtacctgaa
attactcaccactgtccaaagactcctttcctgcttgttgggacccagattgatctaaga
gatgatccctcaacaattgagaaacttgccaagaataagcagaagcccataactccagag
acggctgaaaaactggcccgggacctgaaggctgtcaaatatgtggaatgctctgcactt
acgcagaaaggcctaaagaatgtatttgacgaagcgatattggctgccctggagcctccg
gagccgaagaagactcgcaggtgtgtgctgctatga

DBGET integrated database retrieval system