KEGG   Falco cherrug (Saker falcon): 102056089
Entry
102056089         CDS       T02911                                 

Gene name
BAIAP2
Definition
(RefSeq) brain-specific angiogenesis inhibitor 1-associated protein 2 isoform X1
  KO
K05627  BAI1-associated protein 2
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102056089 (BAIAP2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102056089 (BAIAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102056089 (BAIAP2)
Membrane trafficking [BR:fch04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   I-BAR proteins
    102056089 (BAIAP2)
SSDB
Motif
Pfam: IMD SH3_9 SH3_2 BAR SH3_1 Peptidase_Mx1 BAR_3
Other DBs
NCBI-GeneID: 102056089
NCBI-ProteinID: XP_027657137
LinkDB
Position
Unknown
AA seq 549 aa
MEQFNPSLRNFISMGKTYEKALASMTYAAKGYFDALVKMGELASESQGSKELGDVLFQMA
EVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDSLDKCQAE
LKKLRKKSQGSKNPQKYSDKELQYIEAISNKQGELENYVSDGYKTALTEERRRFCFLVEK
QCAVAKSAITYHAKGKEMLTQKLPLWQQSCSDPNKIPDRAIQLMQQMAASSNGTIMPSPL
STSKSNLIISDPIPGAKPLPVPPELAPFVGRMSAQEAMPVMNGVSGPDSDGYNQWSEMKP
AQPKSLSPPQPQKQLSDSYSNTLPVRKNVPPKNSYTSAENKTLPRSSSMAAGLERNGRTR
VQAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKLRGWFPFSYTRVLDND
GSERVHASLQQGKSSSTGNLLDKDDIAIPPPDYGMASQAFPAQGVNTFKQRPYSVAVPAF
SQDYLMPYGCAIKDYSSGLCQPPSAHYKPYTRSTAGLDDYGTRSVSRNPFANVQLKPTVT
NDRSAPLIS
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggagcagttcaatcccagcctcaggaatttcatttctatggggaagacctatgaaaaa
gccttagcaagtatgacgtatgcagcaaaaggatactttgatgctctggttaagatggga
gagttggccagtgaaagccagggatctaaagaattgggagatgtgcttttccagatggca
gaggtccacaggcagatccagaaccagctggaggagatgctcaagtccttccacaacgag
ctcctgacgcagctggagcagaaggtggagctggactcccggtacctgagtgctgcactg
aaaaaataccagacggagcaaagaagcaagggggactcgctcgacaagtgccaggcagag
ctgaagaaacttcggaagaagagccaaggcagcaaaaacccccagaagtactctgacaag
gagctgcagtacattgaagccatcagcaacaagcaaggtgagctggaaaactacgtctct
gacggctataagacagctcttacagaagagaggagacggttctgcttcctggtagagaag
cagtgtgcagtagcaaagagtgcgatcacttaccatgccaaggggaaggagatgctgacg
cagaagctgccgctgtggcagcagtcctgctcggatcccaacaagatcccggaccgtgct
atacagctgatgcagcagatggctgccagcagcaatggcaccattatgcccagtcctctg
tctacatccaaatccaacctcatcatctctgaccccatccctggtgccaaacctctccct
gttcccccggagctggcaccttttgtaggacgcatgtcggcacaggaggccatgccggtg
atgaacggagtctcaggcccagacagtgacgggtacaaccagtggtctgagatgaagcca
gcacagcccaaatctttatctcctccccagcctcagaagcagctgagtgactcttattcc
aatacactcccagttcgcaaaaacgtgccaccaaaaaacagctacacatcagctgaaaac
aagacactgccgcgctccagctccatggccgcagggctcgagaggaatggcaggacaagg
gtgcaggccattttctctcatgctgccggagataacagcaccctcctgagcttcaaggag
ggtgacctcatcacgctgctggtgccagaggccagggacggctggcattacggggagagc
gagaaaacaaaactgaggggctggtttcctttctcctacacgagggtcctcgacaatgat
ggcagcgagcgcgtccacgcgagcctgcagcaagggaagagcagcagcaccggcaacttg
ctggacaaggacgacatcgccatcccgccgcccgactacggcatggcctcccaagccttc
ccggcacagggcgtcaacaccttcaagcagaggccgtacagcgtggctgtgcctgccttc
tcccaggactacctaatgccctatgggtgtgcaattaaagactattccagtggcctctgc
caaccaccctcggctcactacaaaccttacactaggtcgacagctggtctcgatgactac
gggacaaggtccgtcagcagaaacccctttgccaacgtccagctgaagccaacggtgacg
aacgaccgctcggctccgctcatcagctga

DBGET integrated database retrieval system