KEGG   Falco cherrug (Saker falcon): 102056291
Entry
102056291         CDS       T02911                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04068  FoxO signaling pathway
fch04150  mTOR signaling pathway
fch04520  Adherens junction
fch04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102056291 (INSR)
   04068 FoxO signaling pathway
    102056291 (INSR)
   04150 mTOR signaling pathway
    102056291 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102056291 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102056291 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102056291 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fch04090]
    102056291 (INSR)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102056291 (INSR)
Protein kinases [BR:fch01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102056291 (INSR)
CD molecules [BR:fch04090]
 Proteins
  102056291 (INSR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Insulin_TMD Kinase-like B2
Other DBs
NCBI-GeneID: 102056291
NCBI-ProteinID: XP_005444321
LinkDB
Position
Unknown
AA seq 1324 aa
MDIRNNLTRLNMLENCTVIEGHLQILLMFKTKPEDFRELSFPKLTMITDYLLLFRVYGLE
SLKGLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGAVRIEKNNELCYLST
IDWSRILDSVEDNYIVANKDDKEECGDVCPGTVKGKSNCPPTVINGIFIERCWTHDRCQR
VCPPACKSQGCTSDGQCCHSECLGDCTEPNNPEKCVSCRNFYLEGKCVDTCPPGYYRFEG
WRCVTFSFCQELHNKCKNARESGCHVIHNNECIHECPSGYIMNSSNLHCTPCAGPCPKVC
DYGKEKTIDSVTSAQELRGCTVVNGSLVINIRGGNNIAAELEANLGLIEEISGYLKIRRS
YALVSLSFFRKLHLIRGETLEAGNYSFYALDNQNLRQLWDWSKHNLTIARGKLFFHYNPK
LCLSEIHKMEEISGTKGRQERNDIALKTNGDQASCENELLKFSSIRTSHDKILLKWEPYW
PPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDVDPPPRSNEPKAQAQPGWLL
RGLKPWTQYAVFVKTLVTFSDERRTYGAKSEIIYVQTNATVPSVPLDPISVSNSSSQIIL
KWKPPSEPNGNITHYLVFWQQQAEDSELYELDYCLKGLKLPSRTWSPPFESEDSQKYNQS
ENEDVSGECCSCPKTDSQIQKELEESAFRKTFENYLHNEVFVPRPSRKRRDLGSVANATV
VIPTIASSPNSSAAASENTEEQKPFEKVKSKESLVISGLRHFTGYRIELHACNHDAQESR
CSVAAYVSARTMPEAKADDIVGPVSHELVEKNTVHLKWQEPKEPNGLIVLYEVNYGRLGE
TEEAHYCVSRKHFASEQGCKLRGLQPGNYSVRIRATSLAGNGSWTEPTYFYVADYLNAQP
NIAVIIVPIIFAIIIAGIIGAAYVLVKKRQTEGPTGPLYASSNPEYLSASDVYVPDEWEV
PRDKITLLRELGQGSFGMVYEGIAKDIVKGEPETRVAVKTVNESASLRERIEFLNEASVM
KGFSCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPDAENNPGRPPPTLREMIQ
MAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLL
PVRWMAPESLKDGVFTAYSDVWSFGVVLWEISSLAEQPYQGLSNEQVLKFVMDGGYLDQP
DNCPERLHSLMQMCWQYNPKMRPTFIEIIEMLKEDLHPSFHEVSFFYSEENKPLETEEYE
MDFENMESIPLDPSSYSQRDKVLGRDNGPSMALKGNYEEHIPYTHMNGGKKNGRILSMPR
SSPS
NT seq 3975 nt   +upstreamnt  +downstreamnt
atggacattcgcaacaatctgacccggttgaacatgcttgagaactgcactgtgatcgag
ggccacttgcaaatattgctgatgtttaaaaccaagcctgaagatttccgtgagctcagc
tttcctaaactgacaatgattacagactacttgctgctttttcgtgtgtatggcctggag
agtttaaagggacttttccccaacctcactgtgattcggggaactcatctgttttttaac
tatgcgctcgtcatttttgagatggttcacttgaaagagattggcctctataacctgatg
aacatcactcgaggcgctgtgcggattgagaagaacaacgaattatgttacttgtccacg
atcgactggtcaaggattttggattctgtggaagataattacattgtggccaacaaggat
gacaaagaagagtgtggagatgtgtgtccgggaactgtgaaagggaagagcaactgtccg
cctactgtgataaatggcattttcattgaacgctgctggacccacgatcgctgtcagaga
gtttgtccacctgcctgcaagtcccaaggctgcacctctgatggtcagtgctgtcacagc
gaatgtcttggggactgcacagagccaaacaaccctgaaaaatgcgtgtcttgccgcaac
ttctaccttgagggcaaatgtgtggacacctgcccacccggttactatcgctttgagggg
tggcgttgtgtgaccttcagcttctgccaggaactacacaacaaatgcaaaaatgccagg
gagtcggggtgtcacgttatccacaataacgaatgcattcatgaatgcccgtcagggtac
atcatgaattccagcaacttgcactgtacaccctgcgcagggccctgcccgaaggtttgt
gactatgggaaggagaagacaatcgattcagtgacatcggcgcaggagctccgtggctgc
acagttgttaatggaagcttagttataaatatccgtggaggaaataacatagcagctgag
ctagaagcgaatcttggcttgatagaagaaatctcaggttacctaaaaattcgccggtct
tatgccttggtttctctttctttttttcgtaaactacatctgattaggggagaaacacta
gaagctgggaattactcattttatgcattggacaaccagaatctccgccaactctgggac
tggagtaaacacaacctcactattgcacgaggcaaactcttcttccattataatcccaaa
ctgtgtttgtcagaaatccacaagatggaggagatctctgggactaagggccgtcaggaa
aggaatgacatagccctgaagacaaatggtgatcaagcctcatgtgaaaatgaattgctg
aagttttcatccattagaacttctcatgacaagatcctgttgaagtgggagccgtactgg
cctccagatttccgtgatctcctgggctttatgcttttttacaaagaagccccataccaa
aatgtgacagagtttgatggccaagacgcttgtgggtcaaatagctggacagttgtagat
gtcgacccacctccacggtcaaatgagcccaaagcccaggctcagccaggctggctgcta
aggggcttgaagccatggacacagtatgctgtctttgttaaaactctggtcaccttctcg
gatgaacgaagaacatatggtgcaaagagtgaaatcatctacgtccagaccaacgctact
gttccgtcagtcccattagatccgatatctgtttccaactcttcatcccaaatcattctg
aagtggaagccaccctcggagcccaacgggaacatcacgcactacctggtgttctggcag
cagcaggcagaagatagtgagctgtatgaactcgattactgcttaaaagggttaaaactg
ccctcaaggacgtggtctcctccttttgaatccgaagactcgcagaagtataatcaaagt
gaaaatgaggatgtcagtggagaatgttgttcctgtcctaaaacagactctcaaatacaa
aaggagctggaagaatctgccttccgcaagacgtttgagaactatcttcacaatgaggtt
tttgtccccaggccatcgagaaaacgaagagacctcggctctgtggcaaatgccactgtg
gtgatacccaccatcgcatcctctccaaacagctctgcagcggcatctgagaacacagag
gaacagaaaccttttgaaaaagttaagtcaaaggagtctttggttatctcaggcctgcgg
catttcactgggtatcgcattgagctccacgcttgtaaccatgatgctcaggaatcccga
tgcagtgtggccgcttatgtcagtgccaggaccatgccagaagctaaggctgatgacatc
gtcggtccagttagccatgaattggttgagaaaaataccgtgcacttgaagtggcaagaa
ccaaaggagccaaatggtctaattgtgctgtatgaagtgaattacggacgtctcggggag
acagaggaagcacactactgcgtttcccgtaagcattttgccagcgagcagggctgcaaa
ctccgtggactgcagcctggaaactacagcgtccgtatacgagctacatcactggctgga
aacggctcctggacagaacctacctatttttatgtggctgattatttgaatgctcagcct
aatattgccgttataattgttccgattatttttgccataataattgctgggattattgga
gctgcttatgtgcttgtgaaaaagagacaaaccgaaggaccaactggaccgctctacgca
tcctctaaccctgaatatctcagtgccagtgatgtctatgtccccgacgaatgggaggtt
ccacgagacaagatcactctcctccgagagctgggacagggctccttcggcatggtgtac
gaaggaatcgccaaggacatagtgaagggagagccggagactcgagtagctgtgaaaacc
gttaacgaatccgccagcctccgtgagcgcatcgagttcttaaatgaagcttctgtgatg
aaagggttcagctgccatcatgtggttcgcctcctcggggtggtctcaaaagggcaacct
actctggtggtcatggagttaatggcacacggagatttgaaaagttaccttcgctctttg
agacccgatgctgagaataatcctggtcggccaccaccaacactgagagaaatgatccag
atggctgcggagattgctgatggcatggcctatctgaacgccaaaaaatttgttcataga
gatcttgcggctcgtaactgtatggttgcagaagacttcactgtaaaaattggagacttt
ggcatgaccagagatatctatgagacagactattatcgtaaaggaggcaaaggactgctg
cccgtgcggtggatggcacccgaatcattaaaggatggtgttttcactgcttattccgac
gtgtggtcatttggtgttgtcctttgggaaatcagcagtttagcagagcagccataccag
ggactctccaacgagcaggtgctaaagtttgtaatggatggaggatacctggatcagcca
gacaactgcccggagaggctgcacagcctgatgcagatgtgctggcagtacaacccaaaa
atgcgccccaccttcatcgagatcatcgagatgctgaaggaggatttgcaccccagcttc
catgaggtctcattcttctacagcgaggagaacaaacctctggaaacagaggagtacgag
atggactttgagaacatggagagcattcccctcgatccctcctcgtactcgcagagggac
aaagtgctggggcgggacaatgggccctccatggccctcaaggggaactacgaagagcac
ataccttacactcacatgaacggtggcaagaaaaacgggcggattctctccatgcccagg
tcaagtccctcctaa

DBGET integrated database retrieval system