KEGG   Falco cherrug (Saker falcon): 102056494
Entry
102056494         CDS       T02911                                 

Gene name
NECTIN3
Definition
(RefSeq) nectin-3 isoform X1
  KO
K06592  poliovirus receptor-related protein 3
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04514  Cell adhesion molecules
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102056494 (NECTIN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102056494 (NECTIN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fch04515]
    102056494 (NECTIN3)
   04090 CD molecules [BR:fch04090]
    102056494 (NECTIN3)
Cell adhesion molecules [BR:fch04515]
 Immunoglobulin superfamily
  Nectin family
   102056494 (NECTIN3)
CD molecules [BR:fch04090]
 Proteins
  102056494 (NECTIN3)
SSDB
Motif
Pfam: Ig_3 C2-set_2 ig Ig_2 Ig_6 I-set Sarcoglycan_2
Other DBs
NCBI-GeneID: 102056494
NCBI-ProteinID: XP_027662971
LinkDB
Position
Unknown
AA seq 341 aa
MESSSILFPNETVTVVSQYMIVPTRFARGRRITCIVRHPALEKEIRYPHVLDIQYAPEVS
VTGYDGNWFIGRENVQLRCNADANPLPMEFMWTRLDGQWPDGLLSVNNTLQFSSPLTYNY
TGTYICKVTNSLGQRSDQKTIYILDPPTTTTRLPTVPWHPSTDGITGLATEPRIIDFPSS
TLPAMQEDTWGTVIGSAVGGALFLILVSVLVGIICYRRRRTFRGDYFAKNYIPPSDMQKE
SQIDVLQSDDVDSYPDSIKKEIKHPMNSLISKDYLEDPEKPEWNNIDNINRYQERYERPM
DYYEGGTLGMKYMGGECYDDNEEDFVSHIDGSVISRREWYV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaatccagctctattttgtttccaaatgaaactgtgacagtcgtaagtcagtatatg
attgtccctacacgatttgcaagaggaagacggataacttgtatcgtgaggcaccctgct
ttggaaaaggagataagataccctcatgtgttggacatacagtatgccccagaagtttca
gtaactggctatgatggaaactggttcattggaagagagaacgttcagctcagatgtaat
gctgatgcaaatccattacctatggaatttatgtggaccaggttggatgggcaatggcct
gacggtttgctgtctgtcaacaatactctgcagttcagcagcccattgacttacaactac
actgggacttacatctgtaaggtgactaattcacttggtcagagaagtgatcagaagaca
atctacatattagatcctcctactactaccactcgactgcccacggttccctggcaccct
tcgactgatggcatcacaggtttagcaacagagcctagaataatagatttcccatcatca
accttgccagccatgcaggaagacacttggggtaccgtcatcggtagtgcggtgggtggg
gcgctcttcctcatacttgtcagtgttctggttggaattatctgctataggagaagacgg
acgttccgtggtgactactttgctaagaactacattccaccatcagatatgcagaaagag
tctcaaatagatgttcttcagtcagatgatgtggattcttaccctgacagtataaaaaaa
gagataaagcatccaatgaacagcttaatatctaaagattatttagaagaccctgaaaaa
cctgagtggaacaatatagacaatattaacaggtaccaggaacgttatgaaagaccaatg
gattactatgaaggtggaacattgggaatgaagtatatgggtggtgaatgttatgatgac
aatgaagaagactttgtttctcacatagatggctcggtaatatctcggagggagtggtat
gtgtag

KEGG   Falco cherrug (Saker falcon): 102058210
Entry
102058210         CDS       T02911                                 

Gene name
NECTIN1
Definition
(RefSeq) nectin-1
  KO
K06081  poliovirus receptor-related protein 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04514  Cell adhesion molecules
fch04520  Adherens junction
fch05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102058210 (NECTIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102058210 (NECTIN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102058210 (NECTIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fch04515]
    102058210 (NECTIN1)
   04090 CD molecules [BR:fch04090]
    102058210 (NECTIN1)
Cell adhesion molecules [BR:fch04515]
 Immunoglobulin superfamily
  Nectin family
   102058210 (NECTIN1)
CD molecules [BR:fch04090]
 Proteins
  102058210 (NECTIN1)
SSDB
Motif
Pfam: C2-set_2 V-set ig Ig_3 Ig_2 I-set Ig_6 EphA2_TM DUF5849
Other DBs
NCBI-GeneID: 102058210
NCBI-ProteinID: XP_027662543
LinkDB
Position
Unknown
AA seq 498 aa
MGECRESGLQAQTVLVNDTVSGFIGTDVVLHCSFTNPLPNVKITQVTWQKATNGSKQNVA
IYNPAMGVSILSPYKERVTFRNPSFKDGTIQLSRLELEDEGVYICEFATFPTGNRESQLN
LTVLAKPTNRMEGTKRPLIAKSGRTEKILVATCTSSNGKPPSTVTWDTKLKGEAEFQEIR
NSNGTITVISRYRLVPSREAHRQQLMCVVNYQLDRFTDSMTLNVQYEPEVTIEGFDGNWF
LNRKDVKLICKSDANPPAHTYEWKLPNGTLPGSVEIQNNTIYFKGPVSYNVAGTYICEAS
NAIGTRSGLVEVNVTDKPLPQGAPGGIIGIVGGVIAAALIIGVAVTVIIVYRRQQKNRTE
TDNDLIDLPPSHKPAPPPKRKQEMKSHLTAEDIQVVHLDNMKHEEEIQKLPLQPPYYDMA
ATEPSPYTDKLNSGNKDCDVHYAELDTSALASSPSPRTSIHAGGDLVEMRIKVFVDVTSE
SGQTLESVTQRYRMRVIT
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgggagagtgccgagagagcgggctgcaagctcagactgtcttagtcaatgacacagtc
tcggggtttatcggaacagacgtggtcctgcattgcagcttcaccaatccgctccccaat
gtgaagatcacgcaggtcacgtggcagaaagccaccaacggctccaagcagaatgtggcc
atctacaaccctgccatgggggtctccatcctctctccgtacaaagagcgggtgactttc
cggaatccttccttcaaagatggcaccattcaactctctcggctagagctggaggatgag
ggagtttacatctgtgagtttgccaccttcccaactggcaaccgggaaagtcaactgaac
ctcactgtgctggcgaagcccacaaatcggatggagggcaccaagcggccacttattgct
aagtctggcaggacagaaaagatcttggtagctacctgcacctcctctaatgggaagccc
cccagcactgtcacatgggacaccaagctcaaaggggaagcggagtttcaggagatccgg
aatagcaatggcaccatcacagtgattagccggtaccgactggtgccgagccgggaggcc
catcggcagcagctcatgtgcgtggttaattaccagctggaccgcttcaccgacagcatg
accctcaacgtgcagtatgagccagaagtcactattgagggctttgatggcaactggttt
ctcaaccggaaagatgtgaagctgatatgcaaatctgacgccaaccccccagctcacacc
tatgaatggaagctgccaaacgggactctgccagggagcgtggaaatccagaacaacacc
atctactttaaagggcccgtctcctacaatgtggctggcacctacatctgtgaggcctcc
aacgccatcggtacacggtcgggcttggtggaagtcaatgtcacagataagccactgcct
cagggtgctccaggaggcattattgggatcgtgggaggagtcatcgcagcagctctcatc
atcggcgtggctgtcaccgtaattattgtctacaggcggcaacaaaagaaccgcactgaa
acggacaatgacctaattgacttgcctccatcccacaaacctgcccctccaccaaagagg
aaacaggagatgaaaagccacctgactgcagaagacatccaggttgttcacttagacaac
atgaaacatgaggaggaaatacagaaactccctctgcagcctccatactacgacatggca
gccaccgagccctctccctacactgacaaactgaactctggcaacaaggactgtgatgtc
cactatgcagagctggacacttcagctctggcctcgtcacccagccctcggacctccatc
catgctggcggagacctagtcgaaatgaggatcaaggtcttcgtagacgtaacgagcgag
agtggacaaactttggaaagtgtcactcagagatatcgaatgcgagtgattacctga

KEGG   Falco cherrug (Saker falcon): 102059980
Entry
102059980         CDS       T02911                                 

Gene name
NECTIN4
Definition
(RefSeq) nectin-4
  KO
K06593  poliovirus receptor-related 4
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102059980 (NECTIN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fch04515]
    102059980 (NECTIN4)
Cell adhesion molecules [BR:fch04515]
 Immunoglobulin superfamily
  Nectin family
   102059980 (NECTIN4)
SSDB
Motif
Pfam: C2-set_2 Ig_3 Ig_2 ig I-set Chordopox_A13L EphA2_TM V-set PRIMA1 WSS_VP DUF4446 Protocadherin DUF3169
Other DBs
NCBI-GeneID: 102059980
NCBI-ProteinID: XP_027666035
LinkDB
Position
Unknown
AA seq 508 aa
MSCPECVWVCASVHKCARAQCKRVPKCSCVDVSASTSVRQHECARGARGGGTSVPSERTV
PTWVPAGCRSGVVEVERSVTAVLGQDVGLPCRYRAQEQEEGARRVCSTRRPSAVLGTGFR
ASGSGVTSAGLTPVPPAVPPLPILNPGPPLEEGQGRTLAASCTAEGNPVPSVRWETEVRG
TNATRRSAHARSASVTSEFFLVPGRSMNGKSLTCVVAHPGLRHEKRITHLLSVAYLSDAS
VLGHTEEWQEGMEGATLTCLGDGNPPPAYNWTRWTHPSIHILMHLPTHPHTPISVYPPPI
FLSPPAMPSHPTGVPADNEVRRVDLVSASVVVVGVIAAVLLCVLVVVVVVMTLYHKRKTK
RISEKYEEELTLTRENSIRRLHSSHSTDTRTQLEETLQLRAESRQGSLRGDSLRGTSICS
AMSEEPEGRSYSTLSTVREIETQTEVPAAPLLPTLAGKEPKEEEEDGGGSGGDDPIKQAM
THFVQENGMLQAKPTTNGIYINGRGHLV
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgagctgccctgagtgtgtctgggtgtgtgcaagcgtgcacaagtgtgcccgagcacag
tgcaagcgtgtgcccaagtgttcctgcgtggatgtgagtgccagcacaagtgtgcgccag
cacgagtgtgcccggggagcgcgcggcggcggcacaagtgtgccgagcgagcgcacggtg
ccaacctgggtgcccgcaggctgccgctccggggtggtggaggtggagcgcagcgtgacg
gcggtgctgggccaggacgtggggctgccgtgccggtaccgggcgcaggagcaggaggag
ggggcacggcgggtctgcagtaccaggcgcccatcggctgtgctggggacggggtttcgg
gccagtggctctggtgtcaccagtgcgggtctgacgccggtgccgcctgcagtgcctccg
ctgcccatcctgaacccggggccaccactggaggaggggcagggccggacgctggcggcc
tcgtgcacggcggagggcaacccagtgccatcggtgcgctgggagacggaggtgcggggc
accaacgccacgcgccgctcggcgcacgcccgctccgcctccgtcaccagcgagttcttc
ctggtgcctgggcgcagcatgaatggcaagagcctgacctgcgtggtggcccaccccggg
ctgcgccacgagaagaggatcacccacctcctcagcgtcgcctacctgtcggacgcctct
gtgctggggcacacggaggagtggcaggagggcatggagggggccacgctgacctgcctg
ggggatggcaaccccccgcccgcctacaactggacacgatggacccatccgtccatccac
atactcatgcatttacccacccatccacatactcctatttccgtctatccaccccccatc
ttcttgtccccccccgccatgccttcccaccccacgggtgtccccgcagacaacgaggtg
cgcagggtggacctggtctcagcctcggtggtggtggtgggcgtcatcgccgctgtcctg
ctctgcgtcctcgtcgttgtcgttgttgtcatgaccctctaccacaagcgcaagaccaag
cgcatctccgagaagtacgaggaggagctgacgctcacccgggagaattccatccgccgc
ctgcactccagccacagcaccgacacacgcacccagctggaggagacgctgcagctgcgt
gcggagagccggcaaggcagcctgcgtggggacagcctgcgcggcaccagcatctgctcc
gccatgagcgaagagcccgaagggcgcagctactcgacgctctcgacagtgcgggagatc
gagacgcagacagaggtgccggcagcaccgctgctgcccaccctggcagggaaggagccg
aaggaggaggaggaggatggtggcggcagtggcggggacgaccccatcaagcaggccatg
acccactttgtgcaggagaacgggatgctgcaggccaagcccaccaccaatggcatctac
atcaatggccgcgggcacctggtgtga

DBGET integrated database retrieval system