KEGG   Falco cherrug (Saker falcon): 102056950
Entry
102056950         CDS       T02911                                 

Gene name
PTPRM
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase mu isoform X1
  KO
K05693  receptor-type tyrosine-protein phosphatase mu [EC:3.1.3.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04514  Cell adhesion molecules
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102056950 (PTPRM)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102056950 (PTPRM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102056950 (PTPRM)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102056950 (PTPRM)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    102056950 (PTPRM)
SSDB
Motif
Pfam: Y_phosphatase MAM fn3 ig DSPc PTP_tm Y_phosphatase3 Ig_3 PTPlike_phytase Pur_ac_phosph_N Ig_2 I-set Protocadherin EphA2_TM
Other DBs
NCBI-GeneID: 102056950
NCBI-ProteinID: XP_027658695
LinkDB
Position
Unknown
AA seq 1498 aa
MEKVGTCLVTLAGLLLAAGAQTFTGCCTFDEPLSSCGYSQSDDDDLNWDQVNAPIKPSSG
QGMPSGSFMLVNTSGRFAGQKAHLLLPHLKENDTHCIDFHYYVSSKSGSSPGTLNIYVKV
NDGPIGNPVWNTSITATWNRAELAISTFWPNFYQVVFEVVTSGHPGYVAIDEVKVLGHPC
TKTPHFLRLQSVEVNAGQFATFQCTANGGTDSGDRLWLQGIYVRDAPLKDIKVFNFRRFV
ALFSVVNATKRDAGNYRCMIRTEGGVGVSNYAELIVKEPPVPIAPPQLSSVGATYLWIQL
NANSINGDGPIIQREVEYRTSSGSWYDIQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGG
TGSPGPALKTRTKCADPMRGPRKLEVVEIKSRQITICWEPFGYNVTRCHRYNLTVHYRYQ
AGGQEQVREEVSWDTESSHPQHTITNLSPYTNVSIKLVLMNPEGRKESQELVVQTDEDVP
SAVPLESIQGSTFEEKIYLQWREPAQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVSKL
GNETHCLFFGLYPGTTYSFTIRASTAKGFGPPITNQFTTKISAPSMPPYELETPLNQTDS
TVTVLLKPAQSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASLLNSQYYFA
AEFPANGLQAAQPFTIGDNKTYSGFWNTPLLPHKSYSIYFQAASRANGETKIDCVRVATK
AAIIVTQLTTPYIRIAPAAGDDQLTGAATRKPDPEPEKQTDHTVKIAGVIAGILLFVIIF
LGVVLVMKKRRSYHSYTYYLKLAKKRKETLSSTRQEMTVMVNSMDKSYTEQGTNCDEAFS
FMDTHNLNGRSVSSPSSFTMKTNTLSTTVPNSYYPDPFVPTAILVPINDETHTMVSDTSS
LVQSHTYKKRDPVDVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQSAP
WDSAKKDENRMKNRYGNIIAYDHSRVRLQPIEGETSSDYINGNYIDGYHRPNHYIATQGP
MQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIETELLAE
YVIRTFAVEKRGAHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPNAGPLVVH
CSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEA
CLCGDTSIPASQVRSVYYEMNKLDPQTNSSQIKEEFRTLNMVTPTLRVEDCSIALLPRNH
EKNRCMDVLPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRL
VLDYHCTSIVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRIYNAA
RPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVEKWQEEYNGGEGRTVVHCLNGGG
RSGTFCAISIVCEMLRHQRAVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNSG
NT seq 4497 nt   +upstreamnt  +downstreamnt
atggagaaagttggaacttgcctggttactttggccggacttttgctggcagcgggagcg
cagacgttcacaggatgctgtactttcgatgagcctctcagttcctgtggctatagtcag
tcagatgatgatgatcttaactgggatcaggtgaatgcaccgataaagccctcctcaggt
caagggatgccatctggttctttcatgttggtgaatacatcggggagatttgcgggacag
aaagctcacctcctgctgccccatctgaaagagaatgatacacattgtattgatttccac
tactacgtttcaagcaagagtggatctagccctggcactttgaatatatatgtgaaagtt
aatgatggtcctattggtaacccagtctggaacacatctatcactgctacttggaacaga
gcagaactggcaattagcactttctggcctaatttttatcaggttgtttttgaagtggtt
acttcaggtcacccaggatatgtggctattgatgaagtgaaagttttaggacatccatgt
acaaaaactccccacttcttgcgtcttcagagtgtggaagtcaatgcagggcaatttgct
acttttcaatgcactgccaatggtggaacagactcaggtgacagactctggttacagggt
atttatgtaagggatgcacctttgaaggacataaaagtgttcaacttccgccgatttgta
gctctttttagtgtggtaaatgctacgaagcgggacgctggcaactatcgctgcatgatc
cggacagaaggaggagttggtgtatcaaactatgcagaactgatagtcaaagagccacca
gttcccattgctccacctcagctgtcctcagtcggtgcaacttacctgtggatacagttg
aatgccaattctatcaatggggatggacccattattcaaagggaagttgagtatcgaact
tccagtggaagctggtatgatatacagcctgtggactccacgagctataagattgggcac
ctcgatcctgacacagaatatgaaatcagtgtattacttacaagaccaggtgaaggagga
accggatctcctggcccagctctcaaaacaagaacaaaatgtgctgatccaatgcgtggg
ccacggaagctagaggttgtggagatcaaatctagacaaatcactatctgctgggaacct
tttggatataatgtcacacgttgccatcgatacaaccttacagtccattaccgttaccag
gctggaggacaagagcaagtgagagaagaagtaagctgggatacagaaagttcacatccc
cagcacacaattactaatctatcaccatacacaaatgtcagcatcaaattagtactaatg
aatcccgaaggacgaaaagaaagccaagaactggtagtacaaactgatgaagatgtcccg
agtgctgtgccacttgaatccattcaagggagtacttttgaagagaagatatatcttcaa
tggagagagccagcgcaaacatatggtgtgattactttgtatgagatcacctacaaagca
gtcagctcctttgacccagaaatagatttatccaatcaaagtggacgagtctcaaagcta
ggaaatgaaacgcactgtctcttttttggactgtatcctggcactacgtactcttttacc
atcagagccagcacagctaaaggctttggacctccaatcacaaatcagttcaccactaaa
atatcagcaccctctatgccaccgtatgaacttgaaacacctttgaatcaaactgacagc
actgtgacagtcttgctgaaacctgcacagagcagaggcgctcctgtcagtgtctatcaa
atagttgttgaagaagaacgtccacggaggaccaaaaagacaactgaaatcctgaagtgc
tacccagtgcccattcatttccagaatgcctcgcttctgaattcccagtactactttgct
gcagagtttccagccaatggtttacaagctgctcagccttttactattggtgataacaaa
acctacagtggtttctggaacactcctcttcttcctcataagagctacagcatctatttt
caagctgccagcagagccaatggggaaaccaaaattgactgcgtcagggtagccacaaaa
gctgcgataatcgtgactcagcttacaacaccatacattcgcatcgcccctgctgcaggc
gacgaccaactaacaggggctgccactcgaaaaccagacccagagcctgagaagcagacc
gaccatactgtcaaaattgctggagtcattgcaggcatcttgctgtttgtcatcatattt
ctgggcgtcgtgctggtaatgaagaaaagaagaagctatcactcctacacttactaccta
aaattggctaaaaagcggaaagagacattgagtagcacacggcaggaaatgacagtgatg
gtgaattcaatggataaaagctacactgagcaaggcaccaactgtgacgaagctttctct
ttcatggacacgcacaatctaaatgggagatctgtatcttcaccatcttcatttacaatg
aaaactaacacattgagcacaacagtgcctaattcttactacccagatccatttgtgcca
actgcaattttagtgccaatcaatgatgaaacccatacgatggtcagtgacacaagcagc
ctggtccaatcccatacctacaagaagcgagatccagtggatgtgccctaccagaccgga
cagcttcatccagccatacgtgtagctgacttgctacagcacattacccagatgaagtgt
gcagaaggctatggattcaaagaggagtatgaaagtttctttgaaggacagtctgcacca
tgggattcagctaagaaagatgagaacagaatgaaaaatagatatgggaatatcattgca
tatgatcattctcgagtaagactgcagcccattgaaggagaaacaagttctgattacatc
aatggaaattatattgatggttatcatagaccaaatcactacattgctacacaaggacca
atgcaggagacaatatatgacttttggagaatggtatggcatgaaaacacagccagcata
atcatggttactaatctcgtagaagtgggaagggtcaaatgctgcaaatactggccagat
gacacagagatatataaagacattaaagttaccctaatagaaacagagctcctggctgaa
tatgtgattcgaacatttgcagtagaaaagaggggtgctcatgagattcgagaaattcgg
cagtttcacttcactggctggccagaccacggtgtaccataccatgcaacaggcctgctg
ggatttgtacggcaggtcaaatccaaaagcccaccaaacgctggccctctggttgttcac
tgcagcgctggtgctggcagaactggatgcttcattgttattgacatcatgctagatatg
gcagaaagagaaggtgttgtagacatatacaactgtgtgagagagcttcgatctcggaga
gttaacatggtgcagactgaggaacagtatgttttcatccatgatgctatcctggaagcc
tgtctttgtggggacacatctattccagcttctcaagttaggtctgtttactatgaaatg
aataaactggatcctcaaactaactccagccagatcaaagaggaatttaggactttaaat
atggtgactccgacactgcgtgtagaagactgcagcatagcacttttaccacgaaatcat
gaaaagaatcgctgtatggatgttctgcctccagacagatgcctgcctttcctcataaca
atagatggggagagcagtaactacattaatgctgcactgatggatagctacaagcaaccg
tcagcttttatagttacacagcatcccttaccaaatactgtcaaagatttctggagactg
gtcctagattatcactgcacttcaatagttatgctgaacgatgtggatcctgcacaactg
tgtcctcagtactggccagaaaatggagtacaccgacacggtcctattcaggtggagttt
gtgtcagctgatttagaggaagacataatcagccggatattccgaatttataacgcagcc
agaccccaagacggctatcggatggtgcagcagttccagttcctgggatggcccatgtac
agagacactccagtgtctaaacgttccttcttgaagctcatccgccaagtagagaagtgg
caggaagaatataacgggggagagggacgcacagttgtacattgcttgaatggaggtggc
cgcagtgggacattttgtgcaatcagtattgtttgtgaaatgcttcgacatcagagggct
gttgacgtattccatgctgtgaagacactgaggaataataagcctaacatggtggacctt
ctggatcaatacaaattctgctatgaagtggctctggaatacttgaattctggctga

DBGET integrated database retrieval system