KEGG   Falco cherrug (Saker falcon): 102057058
Entry
102057058         CDS       T02911                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102057058 (TGFA)
   04012 ErbB signaling pathway
    102057058 (TGFA)
SSDB
Motif
Pfam: DUF1180 DAG1
Other DBs
NCBI-GeneID: 102057058
NCBI-ProteinID: XP_027659613
LinkDB
Position
Unknown
AA seq 105 aa
MRALDHLPRGSPGPACVCHSGYVGTRCEHADLLAVVAANQKKQTITALVAVAVVASALLV
AACVLVHCCRLRKRCRWCREPGGGQEKPGGLLKGATSWQATQCSP
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcgggcgctggaccacctcccgcgcggcagccctggcccggcgtgcgtgtgccactcg
gggtacgtggggacgcggtgcgagcacgccgacctgctggccgtggtggccgccaaccag
aagaagcaaaccatcaccgccttggtggcggtggcggtggtggcctcggcgctgctggtg
gcggcgtgcgtcctggtgcactgctgccggctgcggaagcggtgccggtggtgccgggag
cccggcggtgggcaggagaagccgggtgggctcctgaaaggtgccacgtcctggcaggcc
acccagtgcagtccctga

DBGET integrated database retrieval system