KEGG   Falco cherrug (Saker falcon): 102057138Help
Entry
102057138         CDS       T02911                                 

Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
fch  Falco cherrug (Saker falcon)
Brite
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    102057138
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102057138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 102057138
NCBI-ProteinID: XP_005441372
LinkDB All DBs
Position
Un
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcacgaagcagacggcgcgtaagtcgacgggcgggaaggcgccccgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgctgcgcgagatccggcgctaccagaagtcgacggag
ctgctgatccgcaagctgcccttccagcggctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctggctcgccgcatccgtggagagcgggcctga

DBGET integrated database retrieval system