KEGG   Falco cherrug (Saker falcon): 102057401
Entry
102057401         CDS       T02911                                 

Gene name
ACP1
Definition
(RefSeq) low molecular weight phosphotyrosine protein phosphatase isoform X1
  KO
K14394  low molecular weight phosphotyrosine protein phosphatase [EC:3.1.3.2 3.1.3.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00730  Thiamine metabolism
fch00740  Riboflavin metabolism
fch01100  Metabolic pathways
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    102057401 (ACP1)
   00740 Riboflavin metabolism
    102057401 (ACP1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102057401 (ACP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102057401 (ACP1)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     102057401 (ACP1)
    3.1.3.48  protein-tyrosine-phosphatase
     102057401 (ACP1)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein tyrosine phosphatases (PTPs)
  Class II PTPs
   Low molecular weight PTPs (LMWPTPs)
    102057401 (ACP1)
SSDB
Motif
Pfam: LMWPc TMEM206
Other DBs
NCBI-GeneID: 102057401
NCBI-ProteinID: XP_027659848
LinkDB
Position
Unknown
AA seq 147 aa
MAYGNICRSPIAEAVFRKLVTDEKVENKWRIDSAATSAYEIGSPPDYRGQTCMKKHGITM
NHIARQITKDDFQTFDYILCMDESNLRDLKRKSNQVKDCKAKIELLGTYDPQKQLIIEDP
YYGNEKDFETVYEQCVRCCKAFLEKSH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcttacggaaatatttgtcgctctccaatagctgaagcagtttttagaaaacttgta
actgatgaaaaagttgaaaataagtggaggatagacagtgcagcgacatctgcctatgaa
ataggaagccctccagactatcgaggacagacttgcatgaagaagcatggcattaccatg
aatcatattgccaggcagattactaaagacgatttccagacctttgattatatactttgt
atggatgagagcaatctaagagatctgaaaaggaaaagcaaccaagttaaagactgcaag
gccaaaattgaattacttggaacttatgatccacagaaacaacttatcattgaagatccg
tactatgggaatgaaaaggactttgaaactgtttacgagcagtgtgttagatgctgtaaa
gcatttttggagaagtctcattaa

DBGET integrated database retrieval system