KEGG   Falco cherrug (Saker falcon): 102057542
Entry
102057542         CDS       T02911                                 

Gene name
FYN
Definition
(RefSeq) tyrosine-protein kinase Fyn isoform X2
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04510  Focal adhesion
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102057542 (FYN)
   04520 Adherens junction
    102057542 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102057542 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102057542 (FYN)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102057542 (FYN)
Protein kinases [BR:fch01001]
 Non-receptor tyrosine kinases
  SRC family
   102057542 (FYN)
Membrane trafficking [BR:fch04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102057542 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    102057542 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 zf-RING_14
Other DBs
NCBI-GeneID: 102057542
NCBI-ProteinID: XP_005445764
LinkDB
Position
Unknown
AA seq 534 aa
MGCVQCKDKEATKLTDERDGSLTQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHATGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSEKADGLCF
NLTVIATNNTPQTVGLAKDAWEVARDSLFLEQKLGQGCFAEVWRGTWNGNTKVAIKTLKP
GTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALK
LPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTAR
QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGY
RMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGDNL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgactgacgagagggatggc
agtttaactcaaagctcaggctaccgctatgggacagatcccactccacagcactatcct
agctttggtgtgacttcaatcccaaactacaacaacttccatgccacaggaggccaagga
ctgactgtgtttggtggagtcaattcctcctctcatacagggacgctgcgtacaagagga
ggaacaggtgtaactctttttgtggcgctttatgactatgaagcaagaacagaagatgat
ttgagttttcacaaaggagaaaaatttcaaatacttaatagctcggaaggagactggtgg
gaggcccggtccttgacaacaggcgaaactggttacattcccagtaattatgtggctcca
gtcgattccatccaagcagaggagtggtactttggcaaacttggccgaaaagacgccgag
aggcagctgttgtcattcggaaaccccagaggtaccttcctgatccgggaaagtgaaact
accaaaggtgcctattccctgtctattcgagactgggatgatatgaaaggagatcatgtc
aaacattataagatccgtaaacttgacaatggtggatattatatcacaactcgggcacaa
tttgaaactcttcagcagctggttcagcattattcagagaaagctgatggtttgtgtttt
aacttaactgtgattgctacgaataataccccacaaactgttggattggctaaagatgca
tgggaagttgcacgtgattcattatttctggaacagaagcttggtcaggggtgtttcgct
gaagtgtggcgtggtacgtggaacggaaatactaaagtggctatcaagaccctgaagcct
gggactatgtctccagaatccttcttagaggaagcccaaatcatgaagaagctaaaacac
gacaaattggtccaactttatgctgtggtatctgaagaacctatctatattgtcacggag
tacatgagcaaagggagtttgctagatttcttaaaagatggagaaggaagagctttgaag
ttaccgaatttggtggacatggcagcccaggtggctgcaggaatggcatacatcgagcga
atgaattacatacacagagacctgcgatctgcaaatattctggtggggaatggcctaata
tgcaaaattgctgactttggattggcaagactgattgaagacaacgaatatacggccaga
caaggtgccaagttccccattaaatggactgctccagaagcggcattgtatggaaggttc
acaataaagtcagatgtgtggtcttttgggatcctactgacagagctggtaacaaaaggg
agagtgccatacccaggcatgaataaccgtgaagtcttggagcaagtagaacgtggttat
cggatgccatgtcctcaggactgtcccatctccttgcacgagcttatgatccactgctgg
aaaaaagacccagaggagcgtccaaccttcgaatatttgcagggtttccttgaagactac
ttcactgcaacagaaccccagtaccagcctggtgacaacctgtaa

DBGET integrated database retrieval system