KEGG   Falco cherrug (Saker falcon): 102057575
Entry
102057575         CDS       T02911                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04012  ErbB signaling pathway
fch04020  Calcium signaling pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04530  Tight junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102057575 (ERBB2)
   04012 ErbB signaling pathway
    102057575 (ERBB2)
   04020 Calcium signaling pathway
    102057575 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102057575 (ERBB2)
   04520 Adherens junction
    102057575 (ERBB2)
   04530 Tight junction
    102057575 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102057575 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102057575 (ERBB2)
   04090 CD molecules [BR:fch04090]
    102057575 (ERBB2)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102057575 (ERBB2)
Protein kinases [BR:fch01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102057575 (ERBB2)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102057575 (ERBB2)
CD molecules [BR:fch04090]
 Proteins
  102057575 (ERBB2)
SSDB
Motif
Pfam: Recep_L_domain PK_Tyr_Ser-Thr GF_recep_IV Furin-like Pkinase EphA2_TM Adeno_E3_CR2 Protocadherin PTP_tm
Other DBs
NCBI-GeneID: 102057575
NCBI-ProteinID: XP_027661495
LinkDB
Position
Unknown
AA seq 980 aa
MKLLRPSSPESHYETLRHLYQGCQVVQGNLELTYLPPDADTAFLKDIKEVQGYVLIAENQ
VSGLELQSLRIIRGTQLFQERYALAVMGPAGPAGTPGLRQLGMRHLTEILKGPPRHPLLT
SSPGAGPDCQALCAEGHCWGEGPQDCQTREYRPLPTSACLNFNRSGICELHCPPLVIYNS
DTFESVPNRDGRYTFGASCVSQCPYNYLATEVGSCTLVCPQNSQEVTINNVQKCEKCSKP
CPEVDFLKGVRAVNASNIQHFAGCTKILGSLAFLPETFAGDPSTNTPPLDPKLLRIFESL
EELTGFLYIAAWPPSLQDLGVFQNLRVIRGRVLHNGAYSLTLRDLAVRALGLRALQEISS
GMVLVHHNPQLCFLQKVPWDSIFRNPRQRLFQTHNKPPEQCESEGACIPQPAPRPLQEAD
QCVACAHYKDAQQCVRRCPSGVKADASFVPVWKYPDEDGVCQLCPTNCTHSCTIRDEDGC
PMDQKPSQVTSIIAGVVGALLVVVLLLITVICVKRRRQQERKHTMRRLLQETERGEPLTP
SGALPNQAQMRILKETELKKVKVLGSGAFGTVYKGIWIPDGESVKIPVAIKVLRENTSPK
ANKEILDEAYVMAGWAQHQGGCTGGDPGALLTPVPPGVTVWELMTFGAKPYDGIPAREIP
DLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPKFRELVTEFSRMARDPQRFVVIQND
MVGLPGSIDSTFYRALLEEEDMDDLVDAEEYLVPHHGFFSADRDSAGPRALPCTQSTAET
PVDAEEGEGLAPFPFPPQGLVEGPEGPVPEVLEGDAGAKAAVQSTLVQEPGALPRYSEDP
TGLAAEESEGLDAEGFTAPAPCTTMPEYVNQAGEQRSPPRHPRAPPSPPDKPKGHQGKNG
LIKEAKHPFPGPFGHAVENPEYLAPPGPPVPSTFSQAFDNPYYWNQDPPKAGGPEGGPGT
TPTAENPEYLGLAGPDDVAV
NT seq 2943 nt   +upstreamnt  +downstreamnt
atgaagctgctgcgtccctccagcccggagagccactacgagaccctgcggcacctctac
cagggctgccaggtggtgcagggcaacctggagctcacctacctgccccctgatgccgac
accgccttcctcaaggacatcaaggaggtgcagggctacgtgctgatcgcggagaaccaa
gtgagcgggctggagctgcagagcctgcgcatcatccgagggacgcagctcttccaggag
cgttatgccctggctgtgatgggccccgccggccctgccggcacgccggggctgcgccag
ctcggcatgcggcacctcacagagatcctgaagggacccccacgacatcccctgctcacg
tcttcccctggcgcaggtcctgactgccaggcgttgtgtgctgaggggcactgctggggc
gaggggccacaggactgccagacacgtgagtacagacccctgcccacctctgcatgcctg
aacttcaaccggagtgggatctgtgagctgcactgtccccccctcgtcatctacaactca
gacaccttcgagtcagtgcccaaccgcgacgggcgctacacctttggtgccagctgcgtc
agccagtgtccctataactacctcgccacggaggtggggtcctgcacccttgtgtgcccc
cagaacagccaggaggtcaccatcaacaacgtccagaagtgtgagaagtgcagcaagccc
tgcccggaggtggattttctcaagggcgtccgtgctgtgaacgcctccaacatccagcac
ttcgccggctgcaccaagatcttgggcagcctggccttcctgcccgagaccttcgccgga
gaccccagcaccaacacgccgcccctggaccccaaactgctgcggatctttgagagcctg
gaagagctgacgggcttcctctatatcgctgcttggccacccagcttgcaggacctgggc
gtcttccaaaacttgcgggtcatccggggccgcgtgctgcacaacggcgcctactcactg
acgctgcgggacctggcggtgcgggcgctggggctccgtgccctgcaggagatcagcagc
gggatggtgctcgtccaccacaacccccagctctgcttcctccagaaggtgccctgggac
agcatcttccgcaacccccgccagcgcctcttccagacccacaacaagccccccgagcag
tgcgagagcgagggtgcctgcatccctcaacccgccccccgccccttgcaggaggcagac
cagtgcgtggcgtgcgcccactacaaggatgcgcagcagtgcgtgcggcggtgccccagc
ggcgtgaaggcggacgcctccttcgtgcccgtctggaagtacccggatgaagatggtgtc
tgccagctctgccccaccaactgcacccactcgtgcacgatccgggatgaggacggctgt
cccatggaccagaagccaagccaggtgacatccatcatcgccggcgtggtgggggctctg
ctggttgtggtcctcctgctcatcaccgtcatctgcgtcaagcggcggcggcagcaggag
cggaaacacaccatgcggcgcctgctgcaggagaccgagcggggggagccgctgacgccc
agcggagccctccccaaccaggctcagatgcggatcctcaaggagaccgagctcaagaaa
gtgaaagtgttgggctccggtgctttcggcactgtctacaagggcatctggatccctgat
ggggagagcgtgaagatcccggtggccatcaaggtcttgcgggagaacacgtcgcccaaa
gccaacaaggagatcctggacgaggcctacgtgatggcggggtgggctcagcaccaggga
gggtgcacagggggggaccctggggcgctgctgacccctgtccccccaggtgtcaccgtg
tgggagctgatgaccttcggagcgaagccctacgacgggatccccgctcgcgagatcccc
gacctgctggagaagggcgagaggctgccgcagccgcccatctgcaccatcgacgtctac
atgatcatggtgaaatgctggatgattgactccgagtgccggcccaagtttcgggagctg
gtcaccgagttctcccgcatggcccgggacccccagcgcttcgtggtcattcagaacgac
atggtggggctgcccggctccatcgacagcaccttctaccgcgccctgctcgaggaggag
gacatggatgatctggtggatgccgaggagtacctggtccctcaccacggcttcttcagc
gccgaccgggacagcgcgggaccccgtgccctcccctgcacccagagcacggcggagacc
ccggtggacgcagaggagggtgagggcttggcccccttccccttccccccccagggcctg
gtggaggggccggagggcccagtgccggaggtgctggagggggatgccggggccaaggcg
gccgtgcagagcacgttggtgcaggagcccggcgccctgccgcgctacagcgaggatccc
accgggctggcggctgaggagagcgagggtctggatgctgagggcttcaccgccccggcc
ccctgcaccaccatgccagagtatgtgaatcaggctggggagcagcggtccccaccccgg
cacccccgggcacccccgtccccaccggacaagcccaaggggcaccaggggaagaatggg
ctcatcaaggaagccaagcaccccttcccggggcccttcggccatgccgtggagaacccc
gagtacctggcaccccccggcccacccgtccccagcaccttcagccaggccttcgacaac
ccctactactggaaccaggacccccccaaggctggtggccccgagggtggccctggcacg
acgcccacggctgagaaccccgagtacctcggcctggctggccccgatgacgtggccgta
tag

KEGG   Falco cherrug (Saker falcon): 102058683
Entry
102058683         CDS       T02911                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04012  ErbB signaling pathway
fch04020  Calcium signaling pathway
fch04068  FoxO signaling pathway
fch04144  Endocytosis
fch04510  Focal adhesion
fch04520  Adherens junction
fch04540  Gap junction
fch04810  Regulation of actin cytoskeleton
fch04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102058683 (EGFR)
   04012 ErbB signaling pathway
    102058683 (EGFR)
   04068 FoxO signaling pathway
    102058683 (EGFR)
   04020 Calcium signaling pathway
    102058683 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102058683 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102058683 (EGFR)
   04520 Adherens junction
    102058683 (EGFR)
   04540 Gap junction
    102058683 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102058683 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102058683 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102058683 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102058683 (EGFR)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102058683 (EGFR)
Protein kinases [BR:fch01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102058683 (EGFR)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102058683 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   102058683 (EGFR)
  Exosomal proteins of bladder cancer cells
   102058683 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 102058683
NCBI-ProteinID: XP_014140372
LinkDB
Position
Unknown
AA seq 1228 aa
MIHDCLTHIRESNLGSTLPCLALQRFRETGVYHAADSDGNVCQGTNNKLTQLGHVEDHFT
SLQRMYNNCEVVLSNLEITYVEHNRDLSFLKTIQEVAGYVLIALNMVDVIPLENLQIIRG
NVLYDNSYALAVLSNYHMNKTQGLRELPMKRLSEILNGGVKISNNPKLCNMDTVLWNDII
DTSKKPLTVLEFASNLSSCPKCHPNCTEDHCWGPGEQNCQTLTKVICAQQCSGRCRGKVP
SDCCHNQCAAGCTGPRESDCLACRKFRDDATCKDTCPPLVLYNPTTYQMDVNPDGKYSFG
ATCVRECPHNYVVTDHGSCVRSCNTDTYEVEENGVRKCKKCDGLCSKVCNGIGIGELKGI
LSINATNIDSFKNCTKINGDVSILPVAFLGDAFTKTLPLDPKKLDVFKTVKEISGFLLIQ
AWPDNATDLYAFENLEIIRGRTKQHGQYSLAVVNLKIQSLGLRSLKEISDGDVAIMKNKN
LCYADTMDWRSLFATPSQKTKIIQNRNKNECAAARHVCDPLCSDVGCWGPGPFHCFSCRF
FDRQKECVKQCNILQGEPREFERESKCLPCHPECLVQNSTAYNATCTGPGPDNCMKCAHF
IDGPHCVKSCPAGVLGENDTLVWKYADGNAVCQLCHPNCTRGCKGPGLEGCPNGSKIPSI
AAGVVGGLLCLVVVGLGIGLYLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRI
LKETEFKKVKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVM
ASVDNPHVCRLLGICLTSTVQLITQLMPYGCLLDYIREHKDNIGSQYLLNWCVQIAKGMN
YLEERRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGADEKEYHAEGGKVPIKWMALESI
LHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSVLEKGERLPQPPICTIDVYMI
MVKCWMIDADSRPKFRELIAEFSKMARDPPRYLVIQGDDRMHLPSPTDSKFYRTLMEEED
MEDIVDADEYLVPHQGFFNSPSTSRTPLLSSLSATSNNSATTCIDRNGQGHPVREDSFVQ
RYSSDPTGAFLEDSLDDSFLPAPEYVNQLAPKKASASAVQNPIYNNFALTANSKVPTDSS
YQNSHSTAVDNPEYLNTNQSPLAKTVFESSPYWIQAGNHQINLDNPDYQQDFLPKETKPN
GLLKVPAAENPEYLRVAAPKSEYIEASA
NT seq 3687 nt   +upstreamnt  +downstreamnt
atgatccatgactgccttacacatattagagaatccaatttaggttcaactcttccatgc
ctggctcttcagagattcagggagactggggtttaccatgctgctgacagtgatggaaac
gtttgtcaagggacaaataacaagctgacccaactgggacatgtggaagaccatttcacc
agcctgcagaggatgtacaacaactgcgaggtggtactcagcaacctggagattacatac
gtggagcacaatcgtgacctctctttcctgaagacgatacaggaggttgcaggctatgtg
ctcatcgcgcttaacatggtggatgtcattcccttagaaaacctccagatcatccgaggc
aatgtgctgtatgacaactcttacgccctggcagttttatccaattaccacatgaataaa
acccagggactccgagaactgccgatgaaacggctgtcagaaattctcaatggaggtgtt
aaaatcagcaacaaccccaaactgtgcaacatggacaccgttctctggaatgacatcatt
gacacgagcaagaagcctctcacggtgcttgaatttgcaagcaacctgtcttcttgtccc
aaatgccatccgaactgcacagaagaccactgctggggcccaggcgaacagaactgccag
acactaacaaaagtcatctgtgcgcagcagtgctctggccggtgcaggggaaaggtgccc
agtgactgctgccacaaccagtgtgccgcggggtgcacggggcctcgggagagcgactgc
ctggcatgccgcaagtttcgggacgatgctacatgcaaggatacatgtcccccattggtc
ctgtataatcccaccacttatcagatggatgtcaaccctgatggaaaatacagcttcgga
gccacttgtgtgagggaatgtccacacaactacgtggtgactgaccacggctcatgtgtt
cgctcgtgcaataccgatacctatgaagtggaagaaaacggtgttcggaagtgtaaaaag
tgtgatgggctatgcagcaaagtgtgcaatggcattggaataggtgaactcaaagggatc
ctctccataaatgccacaaacatagactccttcaaaaactgtaccaagatcaatggggac
gtcagcattctcccagttgcatttctaggggacgccttcacaaagaccctgccgttggac
cccaagaagttggatgtcttcaaaacagttaaagaaatatcaggatttttgttgattcaa
gcctggcccgataatgctactgatctctatgcttttgaaaatctggagattatacgaggc
agaaccaagcaacatggccagtattcccttgctgttgttaacttgaaaatacagtcctta
gggctgcgctcactcaaggaaataagcgatggagatgtcgccattatgaagaacaagaac
ctctgctacgctgacaccatggactggcgcagcctgtttgcaactccgagccagaaaaca
aagattatacagaacagaaataaaaatgagtgtgctgctgccaggcacgtttgtgacccc
ctgtgctcagacgtgggctgctggggcccaggacccttccactgcttctcctgcaggttt
ttcgatcgccagaaggagtgtgtgaaacagtgcaacatcctgcaaggggagccgagggag
tttgagagggagtccaagtgcctgccctgccaccccgagtgcctggtgcagaactccacc
gcatacaacgcaacctgcactgggcctggccctgacaattgcatgaaatgtgcccatttt
atagacggcccccactgcgtgaaatcctgcccagcaggggttctgggtgagaatgacacc
cttgtctggaaatatgcggatgggaatgcggtttgccagctctgccatcccaactgcacc
cgggggtgcaaagggccaggtcttgaaggctgtccaaatggctccaaaatcccatctatt
gcagctggcgttgtcggaggtctcctgtgcctggtggtggtcggcttgggcatcggcctt
tacttgcggagacgtcacatcgtcagaaagcggaccctgcgccggctgctgcaggagagg
gagctggttgaaccactgacacccagtggggaagcacccaaccaggctcatctgagaatt
ttgaaggaaacagaatttaaaaaggtcaaagttctaggctctggagcttttggcactgtt
tataagggactttggatcccagaaggggagaaggttaaaattcctgtcgctattaaagaa
ttgagagaggctacatcaccaaaagccaacaaggaaatacttgatgaagcttacgtgatg
gctagcgttgacaatcctcatgtgtgccgcttgttgggaatctgcctcacttccactgtt
cagctcatcacacagctgatgccgtacggctgcctcctcgattacatccgagagcacaag
gacaacatcggctcccagtaccttctcaactggtgtgtgcagattgcaaagggcatgaac
tatttggaggagcgtcggctggtacaccgtgaccttgctgccaggaacgtcctcgttaag
actcctcagcatgtgaagatcacggactttgggctggcaaagctgctgggtgccgacgag
aaggagtatcacgctgagggaggcaaggttcctattaagtggatggcattggagtcaatt
ttacaccggatttacacccatcagagtgatgtctggagttatggtgtgacagtttgggag
ctgatgacatttgggtccaagccgtacgatgggatccctgccagcgagatctcctctgtc
ttggagaagggcgagcgtttgccccagcccccaatctgcaccatcgacgtctacatgatc
atggtcaaatgctggatgattgatgcagacagccgtcccaagtttcgtgaactgatagca
gagttctccaaaatggcccgggaccccccacgctacctcgttatacagggagatgacagg
atgcacctgcccagccctacggactccaaattttatcgcaccctgatggaggaggaggac
atggaagatatagtggatgcggatgagtatctcgtgccacaccagggcttcttcaacagc
ccttcaacatcccgcactcctctcttgagttcattgagtgctactagcaacaactctgct
acaacctgcattgacaggaatgggcaggggcaccctgtgagggaagacagcttcgtccag
aggtatagctcagacccaacgggcgctttcctggaggacagcctagacgacagcttcctg
ccagccccggagtacgtaaaccagttggcacccaagaaagcatctgcctcggcagtccag
aatccaatctacaacaacttcgctctcacagcaaactcaaaggtccccacggactccagc
taccagaattcacacagcacagctgtggacaacccggagtatctcaacaccaaccagtct
ccactggccaagacggtcttcgagagctctccttactggatccaggcaggcaaccaccaa
ataaatctggacaatcctgactaccagcaggacttcttaccgaaggaaaccaaacccaat
ggtctcttgaaagttcccgcagcagaaaacccagagtacttaagggtagcagcaccaaaa
agtgaatacattgaagcctcggcatga

DBGET integrated database retrieval system